anti-Human Complement Factor B antibody for Immunohistochemistry

Recommended Complement Factor B Antibody (supplied by: Log in to see )

Antigen
Complement Factor B (CFB) Antibodies
  • AHUS4
  • BF
  • BFD
  • CFAB
  • FB
  • FBI12
  • GBG
  • H2-Bf
  • PBF2
  • bf
  • Bf-1
  • Brre-Bf
  • zgc:114032
  • Bf
  • Sp152
  • bfb-A
  • Bf B
  • LOC397725
  • bf/c2
  • CFB
  • AI195813
  • AI255840
  • B
  • C2
  • Fb
  • Da1-24
  • complement factor B
  • complement factor B S homeolog
  • complement factor B L homeolog
  • CFB
  • cfb
  • bf
  • cfb.S
  • cfb.L
  • bf/c2
  • LOC100555981
  • Cfb
Reactivity
Human
205
57
48
2
1
1
1
1
1
Host
Rabbit
139
85
13
5
1
Clonality
Polyclonal
Conjugate
This Complement Factor B antibody is un-conjugated
28
20
12
4
4
3
3
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
177
129
65
29
21
20
17
14
13
13
12
7
6
4
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4299963
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.858188 ABIN1871801 IHC WB Rabbit IgG Log in to see Polyclonal 0
8.858188 ABIN3015550 IHC WB Rabbit Log in to see Polyclonal 0
1 ABIN4299962 IHC IHC (p) SimWes WB Rabbit IgG Log in to see Polyclonal 4
1 ABIN1858372 ICC IHC WB Rabbit IgG AA 35-160 Log in to see Polyclonal 0
1 ABIN4299964 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN1175357 ICC IHC WB Rabbit IgG AA 270-388 Log in to see Polyclonal 0
1 ABIN1858375 ICC IHC WB Rabbit IgG AA 477-600 Log in to see Polyclonal 0
1 ABIN2896762 IF/ICC IHC IP WB Rabbit AA 35-160 Log in to see Polyclonal 0
1 ABIN5674038 ELISA FACS Func IHC IHC (fro) WB Mouse IgG1 N-Term Log in to see 0
1 ABIN206664 ELISA FACS IHC IHC (fro) WB Mouse IgG1 N-Term Log in to see 0
1 ABIN2990184 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN6260775 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN255394 Func FACS IHC (fro) IHC ELISA WB Mouse IgG1 Log in to see 014III-33-2-4-3 0
1 ABIN601089 ELISA FACS IHC IHC (fro) WB Mouse IgG1 Log in to see 0
1 ABIN601090 ELISA FACS Func IHC IHC (fro) IHC (p) WB Mouse IgG1 Log in to see 0
1 ABIN255392 FACS IHC (fro) IHC ELISA WB Mouse IgG1 Log in to see 10-Sep 0
1 ABIN2594673 ELISA IHC IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN2594671 ELISA IHC IHC (p) WB FITC Rabbit IgG Log in to see Polyclonal 0
1 ABIN2594672 ELISA IHC IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN2879874 IHC WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Complement Factor B (CFB) Antibodies
Reactivity Human
(205), (57), (48), (2), (1), (1), (1), (1), (1)
Host Rabbit
(139), (85), (13), (5), (1)
Clonality
Polyclonal
Conjugate This Complement Factor B antibody is un-conjugated
(28), (20), (12), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(177), (129), (65), (29), (21), (20), (17), (14), (13), (13), (12), (7), (6), (4), (3), (2), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-Complement Factor B Antibody

Target Details Complement Factor B Application Details Handling References for anti-Complement Factor B antibody (ABIN4299963) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKL
Isotype IgG
Plasmids, Primers & others

Target Details Complement Factor B

Product Details anti-Complement Factor B Antibody Application Details Handling References for anti-Complement Factor B antibody (ABIN4299963) Images back to top
Antigen
Alternative Name Complement Factor B (CFB Antibody Abstract)
Background Gene Symbol: CFB
Gene ID 629
Pathways Complement System, Proton Transport, Ribonucleoside Biosynthetic Process

Application Details

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Handling References for anti-Complement Factor B antibody (ABIN4299963) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Application Details References for anti-Complement Factor B antibody (ABIN4299963) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Complement Factor B antibody (ABIN4299963)

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Application Details Handling Images back to top
Product cited in:

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Singh, Kapoun, Higgins, Kutschke, Thurman, Zhang, Singh, Yang, Guan, Lowe, Weiss, Zimmermann, Yull, Blackwell, Mohler, Anderson: "Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart." in: The Journal of clinical investigation, Vol. 119, Issue 4, pp. 986-96, 2009

Images

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Application Details Handling References for anti-Complement Factor B antibody (ABIN4299963) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Complement Factor B (CFB) antibody (ABIN4299963) Immunohistochemistry: Complement Factor B Antibody [NBP1-89986] - Staining of human p...