anti-Human CAPG antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CAPG Antibody (supplied by: Log in to see )

Capping Protein (Actin Filament), Gelsolin-Like (CAPG) Antibodies
  • AFCP
  • MCP
  • gCap39
  • mbh1
  • capping actin protein, gelsolin like
  • capping protein (actin filament), gelsolin-like
  • CAPG
  • Capg
Human, Mouse (Murine), Rat (Rattus)
This CAPG antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4287670
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
7 ABIN1960122 ELISA IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
7 ABIN5573706 ELISA IHC (p) WB Rabbit Log in to see Polyclonal 0
4 ABIN2617880 ELISA IHC IHC (p) WB Goat AA 205-217 Log in to see Polyclonal 0
4 ABIN2617879 ELISA IHC IHC (p) WB Goat AA 147-159 Log in to see Polyclonal 0
4 ABIN5774433 IHC (p) Rabbit IgG Log in to see Polyclonal 0
3.8150444 ABIN4287671 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN1712001 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN1700984 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN1714486 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2962110 IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5611734 EIA IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2962111 IHC (p) ELISA WB Goat AA 205-217, Internal Region Log in to see Polyclonal 0
0.8150444 ABIN4287669 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal 0
-2.1849556 ABIN4287668 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal 0


Antigen Capping Protein (Actin Filament), Gelsolin-Like (CAPG) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(123), (45), (43), (7), (3), (2), (2), (2)
Host Rabbit
(79), (29), (12), (2), (1)
Conjugate This CAPG antibody is un-conjugated
(6), (6), (5), (5), (5), (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(101), (67), (34), (19), (14), (13), (9), (6), (5), (4), (2), (1)
Supplier Log in to see

Product Details anti-CAPG Antibody

Target Details CAPG Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQF
Isotype IgG
Plasmids, Primers & others

Target Details CAPG

Product Details anti-CAPG Antibody Application Details Handling Images back to top
Alternative Name CapG (CAPG Antibody Abstract)
Background Gene Symbol: CAPG
Molecular Weight Theoretical MW: 38 kDa
Gene ID 822
UniProt P40121
Pathways Regulation of Actin Filament Polymerization

Application Details

Product Details anti-CAPG Antibody Target Details CAPG Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-CAPG Antibody Target Details CAPG Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-CAPG Antibody Target Details CAPG Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Capping Protein (Actin Filament), Gelsolin-Like (CAPG) antibody (ABIN4287670) Immunocytochemistry/Immunofluorescence: Actin Regulatory Protein Antibody [NBP1-90215...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Capping Protein (Actin Filament), Gelsolin-Like (CAPG) antibody (ABIN4287670) Immunohistochemistry-Paraffin: Actin Regulatory Protein Antibody [NBP1-90215] - Immun...
Western Blotting (WB) image for anti-Capping Protein (Actin Filament), Gelsolin-Like (CAPG) antibody (ABIN4287670) Western Blot: Actin Regulatory Protein Antibody [NBP1-90215] - Lane 1: Marker [kDa] 2...
Western Blotting (WB) image for anti-Capping Protein (Actin Filament), Gelsolin-Like (CAPG) antibody (ABIN4287670) Western Blot: Actin Regulatory Protein Antibody [NBP1-90215] - Lane 1: NIH-3T3 cell l...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Capping Protein (Actin Filament), Gelsolin-Like (CAPG) antibody (ABIN4287670) Immunohistochemistry-Paraffin: CapG Antibody - Staining of human lung shows strong c...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Capping Protein (Actin Filament), Gelsolin-Like (CAPG) antibody (ABIN4287670) Immunohistochemistry-Paraffin: CapG Antibody - Staining of human skeletal muscle sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Capping Protein (Actin Filament), Gelsolin-Like (CAPG) antibody (ABIN4287670) Immunohistochemistry-Paraffin: CapG Antibody - Staining in human parathyroid gland a...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Capping Protein (Actin Filament), Gelsolin-Like (CAPG) antibody (ABIN4287670) Immunohistochemistry-Paraffin: CapG Antibody - Staining of human parathyroid gland s...