anti-Mouse (Murine) CAPZB antibody for Immunocytochemistry

Recommended CAPZB Antibody (supplied by: Log in to see )

Capping Protein (Actin Filament) Muscle Z-Line, beta (CAPZB) Antibodies
  • CAPB
  • CAPZ
  • wu:fk65f06
  • zgc:66149
  • MGC52754
  • capzb
  • 1700120C01Rik
  • AI325129
  • CPB1
  • CPB2
  • CPbeat2
  • CPbeta1
  • CPbeta2
  • Cappb1
  • capping actin protein of muscle Z-line beta subunit
  • capping protein (actin filament) muscle Z-line, beta
  • F-actin-capping protein subunit beta
  • f-actin-capping protein subunit beta
  • capping protein (actin filament) muscle Z-line, beta L homeolog
  • capzb
  • AOR_1_1412174
  • MCYG_05913
  • VDBG_04956
  • MGYG_06053
  • PGTG_03178
  • Tsp_07516
  • capzb.L
  • Capzb
Human, Mouse (Murine), Rat (Rattus)
This CAPZB antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4287696
Contact our Customer Service for availability and price in your country.


Antigen Capping Protein (Actin Filament) Muscle Z-Line, beta (CAPZB) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(79), (18), (16), (8), (7), (5), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(48), (18), (14), (1)
Conjugate This CAPZB antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(80), (46), (10), (8), (4), (2), (1), (1)
Supplier Log in to see

Product Details anti-CAPZB Antibody

Target Details CAPZB Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
Isotype IgG
Plasmids, Primers & others

Target Details CAPZB

Product Details anti-CAPZB Antibody Application Details Handling Images back to top
Alternative Name CAPZB (CAPZB Antibody Abstract)
Background Gene Symbol: CAPZB
Gene ID 832
Pathways Regulation of Actin Filament Polymerization

Application Details

Product Details anti-CAPZB Antibody Target Details CAPZB Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-CAPZB Antibody Target Details CAPZB Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-CAPZB Antibody Target Details CAPZB Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Capping Protein (Actin Filament) Muscle Z-Line, beta (CAPZB) antibody (ABIN4287696) Immunocytochemistry/Immunofluorescence: CAPZB Antibody [NBP1-85922] - Immunofluoresce...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Capping Protein (Actin Filament) Muscle Z-Line, beta (CAPZB) antibody (ABIN4287696) Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human stomac...
Western Blotting (WB) image for anti-Capping Protein (Actin Filament) Muscle Z-Line, beta (CAPZB) antibody (ABIN4287696) Western Blot: CAPZB Antibody [NBP1-85922] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Western Blotting (WB) image for anti-Capping Protein (Actin Filament) Muscle Z-Line, beta (CAPZB) antibody (ABIN4287696) Western Blot: CAPZB Antibody [NBP1-85922] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...