anti-Human SLIT1 antibody for Western Blotting

Recommended SLIT1 Antibody (supplied by: Log in to see )

Slit Homolog 1 (Drosophila) (SLIT1) Antibodies
  • Slil1
  • mKIAA0813
  • MEGF4
  • SLIL1
  • SLIT-1
  • SLIT3
  • megf4
  • slil1
  • slit-1
  • SLIT1
  • slit3
  • slit homolog 1 (Drosophila)
  • slit guidance ligand 1
  • slit guidance ligand 1 S homeolog
  • slit homolog 1 protein
  • slit homolog 1a (Drosophila)
  • Slit1
  • SLIT1
  • slit1.S
  • slit1
  • LOC100459557
  • slit1a
This SLIT1 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN633869
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
16.803753 ABIN1860574 ICC IHC WB Rabbit IgG AA 647-835 Log in to see Polyclonal 0
16.803753 ABIN2911773 IF/ICC IHC IP WB Rabbit AA 647-835 Log in to see Polyclonal 0
10 ABIN214602 ELISA IHC IHC (p) WB Rabbit AA 487-504 Log in to see Polyclonal 0
7.803753 ABIN1176116 ICC IHC WB Rabbit IgG AA 345-623 Log in to see Polyclonal 0
7.803753 ABIN2911772 IF/ICC IHC IP WB Rabbit AA 345-623 Log in to see Polyclonal 0
7 ABIN303378 EIA IF IHC (p) WB Rabbit AA 487-504 Log in to see Polyclonal 0
7 ABIN1804828 IHC IHC (p) WB Rabbit AA 84-113 Log in to see Polyclonal 0
7 ABIN1739431 IF IHC (p) ELISA WB Rabbit IgG AA 487-504 Log in to see Polyclonal 0
4 ABIN2774236 IHC WB Rabbit Middle Region Log in to see Polyclonal 1
4 ABIN470338 WB Rabbit AA 1439-1488 Log in to see Polyclonal 0
4 ABIN2470344 IF IHC ELISA WB Rabbit AA 155-173 Log in to see Polyclonal 0
4 ABIN1387455 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2571759 WB FITC Rabbit IgG AA 345-623 Log in to see Polyclonal 0
1 ABIN2571762 WB FITC Rabbit IgG AA 647-835 Log in to see Polyclonal 0
1 ABIN2571756 WB Biotin Rabbit IgG AA 345-623 Log in to see Polyclonal 0
1 ABIN2628445 WB Biotin Rabbit IgG AA 647-835 Log in to see Polyclonal 0
1 ABIN2571763 ELISA IHC WB Rabbit IgG AA 84-113 Log in to see Polyclonal 0
1 ABIN2571749 WB Rabbit IgG AA 345-623 Log in to see Polyclonal 0
1 ABIN2571754 WB Rabbit IgG AA 647-835 Log in to see Polyclonal 0
1 ABIN1409450 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0


Antigen Slit Homolog 1 (Drosophila) (SLIT1) Antibodies
Reactivity Human
(60), (40), (38), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
Conjugate This SLIT1 antibody is un-conjugated
(16), (10), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(78), (44), (29), (14), (10), (10), (7), (7), (4), (2), (1)
Supplier Log in to see

Product Details anti-SLIT1 Antibody

Target Details SLIT1 Application Details Handling Images
Purification Affinity purified
Immunogen SLIT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
Plasmids, Primers & others

Target Details SLIT1

Product Details anti-SLIT1 Antibody Application Details Handling Images back to top
Alternative Name SLIT1 (SLIT1 Antibody Abstract)
Background SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors.
Molecular Weight 168 kDa (MW of target protein)
Pathways Regulation of Cell Size

Application Details

Product Details anti-SLIT1 Antibody Target Details SLIT1 Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

SLIT1 Blocking Peptide, catalog no. 33R-3156, is also available for use as a blocking control in assays to test for specificity of this SLIT1 antibody

Restrictions For Research Use only


Product Details anti-SLIT1 Antibody Target Details SLIT1 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLIT1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-SLIT1 Antibody Target Details SLIT1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Slit Homolog 1 (Drosophila) (SLIT1) antibody (ABIN633869) SLIT1 antibody used at a concentration of 2 and 10 ug/ml to detect gut tissue. Goat a...
Western Blotting (WB) image for anti-Slit Homolog 1 (Drosophila) (SLIT1) antibody (ABIN633869) SLIT1 antibody used at 1 ug/ml to detect target protein.