anti-Human BMP5 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended BMP5 Antibody (supplied by: Log in to see )

Antigen
Bone Morphogenetic Protein 5 (BMP5) Antibodies
  • bmp5l
  • hm:zehl0669
  • zehl0669
  • zgc:64230
  • BMP5
  • AU023399
  • se
  • bone morphogenetic protein 5
  • bmp5
  • BMP5
  • LOC100539495
  • Bmp5
Epitope
AA 332-365, C-Term
15
13
12
11
10
10
7
7
6
6
5
4
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
143
48
22
2
2
2
1
1
1
1
1
1
1
Host
Rabbit
103
39
15
Clonality
Polyclonal
Conjugate
This BMP5 antibody is un-conjugated
13
8
5
4
4
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
102
68
51
16
13
6
6
6
4
4
4
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043800
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
14.494791 ABIN214627 ELISA IHC IHC (p) Rabbit AA 31-46 Log in to see Polyclonal 0
11.5 ABIN544632 IHC (p) ELISA WB Rabbit Log in to see Polyclonal 3
11.494791 ABIN498479 IHC (p) WB Rabbit Log in to see Polyclonal 0
10 ABIN388455 IHC (p) WB Rabbit Ig Fraction AA 16-46, N-Term Log in to see Polyclonal 2
7 ABIN357183 EIA IHC (p) WB Rabbit Ig Fraction N-Term Log in to see Polyclonal 5
7 ABIN5530547 IHC (p) WB Rabbit Ig Fraction AA 16-46, N-Term Log in to see Polyclonal 0
7 ABIN1732368 IHC (p) ELISA Rabbit IgG AA 31-46 Log in to see Polyclonal 0
5.5 ABIN718871 IF (p) IHC (p) WB Rabbit IgG AA 330-380 Log in to see Polyclonal 1
4 ABIN5955937 ELISA IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN718880 IHC (p) WB HRP Rabbit IgG AA 330-380 Log in to see Polyclonal 0
1 ABIN2892850 IHC IHC (p) WB Rabbit Leu163 Log in to see Polyclonal 0
1 ABIN718873 IHC (p) WB Biotin Rabbit IgG AA 330-380 Log in to see Polyclonal 0
1 ABIN1840640 IHC IHC (p) WB Rabbit AA 16-46 Log in to see Polyclonal 0
1 ABIN2767332 ELISA IHC (p) Rabbit AA 31-46 Log in to see Polyclonal 0
1 ABIN5551452 EIA IHC (p) Rabbit AA 31-46 Log in to see Polyclonal 0
1 ABIN4950346 ELISA FACS IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Bone Morphogenetic Protein 5 (BMP5) Antibodies
Epitope AA 332-365, C-Term
(15), (13), (12), (11), (10), (10), (7), (7), (6), (6), (5), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(143), (48), (22), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(103), (39), (15)
Clonality
Polyclonal
Conjugate This BMP5 antibody is un-conjugated
(13), (8), (5), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
(102), (68), (51), (16), (13), (6), (6), (6), (4), (4), (4), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-BMP5 Antibody

Target Details BMP5 Application Details Handling References for anti-BMP5 antibody (ABIN3043800) Images
Purpose Rabbit IgG polyclonal antibody for Bone morphogenetic protein 5(BMP5) detection. Tested with WB, IHC-P, ELISA in Human,Mouse,Rat.
Sequence HQDSSRMSSV GDYNTSEQKQ ACKKHELYVS FRDL
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Bone morphogenetic protein 5(BMP5) detection. Tested with WB, IHC-P, ELISA in Human,Mouse,Rat.
Gene Name: bone morphogenetic protein 5
Protein Name: Bone morphogenetic protein 5
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Isotype IgG
Plasmids, Primers & others

Target Details BMP5

Product Details anti-BMP5 Antibody Application Details Handling References for anti-BMP5 antibody (ABIN3043800) Images back to top
Antigen
Alternative Name BMP5 (BMP5 Antibody Abstract)
Background Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

Synonyms: BMP 5 antibody|BMP-5 antibody|Bmp5 antibody|BMP5_HUMAN antibody|Bone morphogenetic protein 5 antibody|MGC34244 antibody
Gene ID 653
UniProt P22003
Pathways Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process

Application Details

Product Details anti-BMP5 Antibody Target Details BMP5 Handling References for anti-BMP5 antibody (ABIN3043800) Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-BMP5 Antibody Target Details BMP5 Application Details References for anti-BMP5 antibody (ABIN3043800) Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-BMP5 antibody (ABIN3043800)

Product Details anti-BMP5 Antibody Target Details BMP5 Application Details Handling Images back to top
Product cited in:

Wang, Xue, Zhao, Liu, Ma, Ma: "Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, 2015

Images

Product Details anti-BMP5 Antibody Target Details BMP5 Application Details Handling References for anti-BMP5 antibody (ABIN3043800) back to top
Supplier Images
Western Blotting (WB) image for anti-Bone Morphogenetic Protein 5 (BMP5) (AA 332-365), (C-Term) antibody (ABIN3043800) anti-Bone Morphogenetic Protein 5 (BMP5) (AA 332-365), (C-Term) antibody
Immunohistochemistry (IHC) image for anti-Bone Morphogenetic Protein 5 (BMP5) (AA 332-365), (C-Term) antibody (ABIN3043800) Anti- BMP5 Picoband antibody, IHC(P) IHC(P): Human Lung Cancer Tissue
Immunohistochemistry (IHC) image for anti-Bone Morphogenetic Protein 5 (BMP5) (AA 332-365), (C-Term) antibody (ABIN3043800) Anti- BMP5 Picoband antibody, IHC(P) IHC(P): Mouse Liver Tissue
Immunohistochemistry (IHC) image for anti-Bone Morphogenetic Protein 5 (BMP5) (AA 332-365), (C-Term) antibody (ABIN3043800) Anti- BMP5 Picoband antibody, IHC(P) IHC(P): Rat Lung Tissue
Flow Cytometry (FACS) image for anti-Bone Morphogenetic Protein 5 (BMP5) (AA 332-365), (C-Term) antibody (ABIN3043800) Flow Cytometry analysis of U20S cells using anti-BMP5 antibody . Overlay histogram sh...
Western Blotting (WB) image for anti-Bone Morphogenetic Protein 5 (BMP5) (AA 332-365), (C-Term) antibody (ABIN3043800) Anti- BMP-5 Picoband antibody, Western blottingAll lanes: Anti BMP-5 at 0.5ug/ml La...