anti-Human CACNA1A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CACNA1A Antibody (supplied by: Log in to see )

Antigen
Calcium Channel, Voltage-Dependent, P/Q Type, alpha 1A Subunit (CACNA1A) Antibodies
  • cav2.1
  • cacna-a
  • ca(v)2.1
  • cacna1a
  • si:ch211-237k17.1
  • BccA1
  • Cav2.1
  • rbA-1
  • APCA
  • BI
  • CACNL1A4
  • CAV2.1
  • EA2
  • FHM
  • HPCA
  • MHP
  • MHP1
  • SCA6
  • Caca1a
  • Cacnl1a4
  • Ccha1a
  • alpha1A
  • la
  • leaner
  • nmf352
  • rkr
  • rocker
  • tg
  • tottering
  • CACH4
  • CACN3
  • calcium channel, voltage-dependent, P/Q type, alpha 1A subunit S homeolog
  • calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, a
  • calcium voltage-gated channel subunit alpha1 A
  • calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
  • P/Q-type voltage-gated calcium channel alpha1A subunit ChCaChA1A
  • cacna1a.S
  • cacna1aa
  • CACNA1A
  • Cacna1a
  • LOC395892
Reactivity
Human
28
23
21
1
1
1
1
1
1
Host
Rabbit
29
1
Clonality
Polyclonal
Conjugate
This CACNA1A antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
13
12
8
3
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4286740
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN751312 IHC (p) HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN751305 IHC (p) Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN751303 IF (p) IHC (p) Rabbit IgG Log in to see Polyclonal 0

General

Antigen Calcium Channel, Voltage-Dependent, P/Q Type, alpha 1A Subunit (CACNA1A) Antibodies
Reactivity Human
(28), (23), (21), (1), (1), (1), (1), (1), (1)
Host Rabbit
(29), (1)
Clonality
Polyclonal
Conjugate This CACNA1A antibody is un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(13), (12), (8), (3), (2), (2), (1)
Supplier Log in to see

Product Details anti-CACNA1A Antibody

Target Details CACNA1A Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI
Plasmids, Primers & others

Target Details CACNA1A

Product Details anti-CACNA1A Antibody Application Details Handling Images back to top
Antigen
Alternative Name CACNA1A (CACNA1A Antibody Abstract)
Background Gene Symbol: CACNA1A
Gene ID 773
UniProt O00555
Pathways Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process

Application Details

Product Details anti-CACNA1A Antibody Target Details CACNA1A Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CACNA1A Antibody Target Details CACNA1A Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CACNA1A Antibody Target Details CACNA1A Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Calcium Channel, Voltage-Dependent, P/Q Type, alpha 1A Subunit (CACNA1A) antibody (ABIN4286740) Immunohistochemistry: CACNA1A Antibody [NBP2-38049] - Staining of human cerebral cort...
Immunofluorescence (IF) image for anti-Calcium Channel, Voltage-Dependent, P/Q Type, alpha 1A Subunit (CACNA1A) antibody (ABIN4286740) Immunocytochemistry/Immunofluorescence: CACNA1A Antibody - Immunofluorescent stainin...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium Channel, Voltage-Dependent, P/Q Type, alpha 1A Subunit (CACNA1A) antibody (ABIN4286740) Immunohistochemistry-Paraffin: CACNA1A Antibody - Staining of human pancreas shows l...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium Channel, Voltage-Dependent, P/Q Type, alpha 1A Subunit (CACNA1A) antibody (ABIN4286740) Immunohistochemistry-Paraffin: CACNA1A Antibody - Staining in human cerebral cortex ...