anti-Human Hepsin antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Hepsin Antibody (supplied by: Log in to see )

Antigen
Hepsin (HPN) Antibodies
  • TMPRSS1
  • Hlb320
  • hepsin
  • si:dkey-33i11.3
  • HPN
  • si:dkey-33i11.3
  • Hpn
Reactivity
Human
52
21
18
4
4
4
3
3
1
1
1
1
1
1
1
1
Host
Rabbit
44
5
2
1
Clonality
Polyclonal
Conjugate
This Hepsin antibody is un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
35
22
13
10
7
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4317046
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.341051 ABIN716816 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
12.341051 ABIN4317047 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN962577 IHC IHC (p) WB Rabbit IgG AA 241-260 Log in to see Polyclonal 0
1 ABIN1735563 IHC (p) WB Rabbit IgG AA 241-260 Log in to see Polyclonal 0
1 ABIN716825 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN716818 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN2770981 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Hepsin (HPN) Antibodies
Reactivity Human
(52), (21), (18), (4), (4), (4), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(44), (5), (2), (1)
Clonality
Polyclonal
Conjugate This Hepsin antibody is un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(35), (22), (13), (10), (7), (3), (1)
Supplier Log in to see

Product Details anti-Hepsin Antibody

Target Details Hepsin Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHL
Isotype IgG
Plasmids, Primers & others

Target Details Hepsin

Product Details anti-Hepsin Antibody Application Details Handling Images back to top
Antigen
Alternative Name Hepsin (HPN Antibody Abstract)
Background Gene Symbol: HPN
Gene ID 3249
Pathways Regulation of Hormone Metabolic Process, Sensory Perception of Sound

Application Details

Product Details anti-Hepsin Antibody Target Details Hepsin Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Hepsin Antibody Target Details Hepsin Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Hepsin Antibody Target Details Hepsin Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Hepsin (HPN) antibody (ABIN4317046) Western Blot: Hepsin Antibody [NBP1-86931] - Lane 1: Marker [kDa] 250, 130, 95, 72, 5...
Immunofluorescence (IF) image for anti-Hepsin (HPN) antibody (ABIN4317046) Immunocytochemistry/Immunofluorescence: Hepsin Antibody [NBP1-86931] - Staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Hepsin (HPN) antibody (ABIN4317046) Immunohistochemistry-Paraffin: Hepsin Antibody [NBP1-86931] - Immunohistochemical sta...
Western Blotting (WB) image for anti-Hepsin (HPN) antibody (ABIN4317046) Western Blot: Hepsin Antibody - Analysis in control (vector only transfected HEK293T...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Hepsin (HPN) antibody (ABIN4317046) Immunohistochemistry-Paraffin: Hepsin Antibody - Staining of human liver shows moder...