anti-Rat (Rattus) POR antibody for Western Blotting

Recommended POR Antibody (supplied by: Log in to see )

P450 (Cytochrome) Oxidoreductase (POR) Antibodies
  • CPR
  • P450R
  • POR
  • CCR
  • CG11567
  • DMR
  • DmCPR
  • Dmel\\CG11567
  • NCPR
  • P450
  • cpr
  • zgc:110032
  • npr
  • xpor
  • 4933424M13Rik
  • T5J17.90
  • T5J17_90
  • TFC C
  • cytochrome p450 oxidoreductase
  • P450 (cytochrome) oxidoreductase
  • Cytochrome P450 reductase
  • P450 (cytochrome) oxidoreductase a
  • P450 (cytochrome) oxidoreductase L homeolog
  • NADPH--cytochrome P450 reductase
  • C-CAP/cofactor C-like domain-containing protein
  • POR
  • Por
  • Cpr
  • pora
  • por.L
  • LOC100406157
  • por
  • LOC100619047
AA 633-668, C-Term
Human, Mouse (Murine), Rat (Rattus)
This POR antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043443
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.2307212 ABIN3044023 ICC IHC (p) WB Rabbit IgG AA 659-677, C-Term Log in to see Polyclonal 0
3.2307212 ABIN2464729 ELISA WB Goat Internal Region Log in to see Polyclonal 0
3.2307212 ABIN568710 EIA WB Goat Internal Region Log in to see Polyclonal 0
3.2307212 ABIN2482131 ICC IF IHC WB PE Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482116 ICC IF IHC WB Atto 390 Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482126 ICC IF IHC WB Biotin Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482125 ICC IF IHC WB APC Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482118 ICC IF IHC WB Atto 565 Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482127 ICC IF IHC WB FITC Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482119 ICC IF IHC WB Atto 594 Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482123 ICC IF IHC WB Atto 700 Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482120 ICC IF IHC WB Atto 633 Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482132 ICC IF IHC WB Streptavidin Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482124 ICC IF IHC WB Alkaline Phosphatase (AP) Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482130 ICC IF IHC WB PerCP Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482122 ICC IF IHC WB Atto 680 Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482117 ICC IF IHC WB Atto 488 Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482128 ICC IF IHC WB HRP Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482121 ICC IF IHC WB Atto 655 Rabbit Log in to see Polyclonal 3
3.2307212 ABIN2482129 ICC IF IHC WB PE-Atto 594 Rabbit Log in to see Polyclonal 3


Antigen P450 (Cytochrome) Oxidoreductase (POR) Antibodies
Epitope AA 633-668, C-Term
(7), (6), (6), (5), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(115), (47), (46), (11), (11), (11), (9), (8), (6), (6), (5), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Host Rabbit
(71), (31), (17), (3)
Conjugate This POR antibody is un-conjugated
(4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(109), (59), (49), (31), (26), (23), (20), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-POR Antibody

Target Details POR Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase(POR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase(POR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: P450 (cytochrome) oxidoreductase
Protein Name: NADPH--cytochrome P450 reductase
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
Isotype IgG

Target Details POR

Product Details anti-POR Antibody Application Details Handling Images back to top
Alternative Name POR (POR Antibody Abstract)
Background POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Synonyms: CPR antibody|CYPOR antibody|DKFZp686G04235 antibody|FLJ26468 antibody|NADPH Cytochrome P450 Reductase antibody|NADPH dependent cytochrome P450 reductase antibody|NADPH--cytochrome P450 reductase antibody|NCPR_HUMAN antibody|P450 (cytochrome) oxidoreductase antibody|P450 Cytochrome Oxidoreductase antibody|P450R antibody|POR antibody
Gene ID 5447
UniProt P16435
Pathways Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process

Application Details

Product Details anti-POR Antibody Target Details POR Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only


Product Details anti-POR Antibody Target Details POR Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-POR Antibody Target Details POR Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-P450 (Cytochrome) Oxidoreductase (POR) (AA 633-668), (C-Term) antibody (ABIN3043443) Anti- POR Picoband antibody,IHC(P) IHC(P): Human Mammary Cancer Tissue
Western Blotting (WB) image for anti-P450 (Cytochrome) Oxidoreductase (POR) (AA 633-668), (C-Term) antibody (ABIN3043443) anti-P450 (Cytochrome) Oxidoreductase (POR) (AA 633-668), (C-Term) antibody (Image 2)
Immunohistochemistry (IHC) image for anti-P450 (Cytochrome) Oxidoreductase (POR) (AA 633-668), (C-Term) antibody (ABIN3043443) Anti- POR Picoband antibody,IHC(P) IHC(P): Mouse Intestine Tissue
Immunohistochemistry (IHC) image for anti-P450 (Cytochrome) Oxidoreductase (POR) (AA 633-668), (C-Term) antibody (ABIN3043443) Anti- POR Picoband antibody,IHC(P) IHC(P): Rat Intestine Tissue