anti-Rat (Rattus) ALAS1 antibody for Western Blotting

Recommended ALAS1 Antibody (supplied by: Log in to see )

Antigen
Aminolevulinate, delta-, Synthase 1 (ALAS1) Antibodies
  • ALAS
  • ALAS3
  • ALASH
  • MIG4
  • ALAS-N
  • Alas-1
  • Alas-h
  • ALAS-H
  • ALASN
  • ALAS1
  • wu:fb58d01
  • wu:fi12g09
  • 5'-aminolevulinate synthase 1
  • aminolevulinic acid synthase 1
  • alanyl-tRNA synthetase protein
  • aminolevulinate, delta-, synthase 1
  • ALAS1
  • Alas1
  • alas1
  • alas1.S
  • alaS1
Epitope
N-Term
7
4
4
4
3
2
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
70
29
29
2
2
2
2
1
1
1
1
1
Host
Rabbit
59
14
Clonality
Polyclonal
Conjugate
This ALAS1 antibody is un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
51
16
14
13
11
10
4
4
2
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN631001
$ 510.36
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
7.781914 ABIN4279106 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
4.8063846 ABIN2785663 WB Rabbit N-Term Log in to see Polyclonal 1
4.8063846 ABIN2459736 ELISA WB Rabbit Log in to see Polyclonal 0
4.8063846 ABIN2969414 WB Rabbit IgG Log in to see Polyclonal 0
4.8063846 ABIN6570493 WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN2738227 IHC IHC (p) WB Rabbit IgG AA 146-195 Log in to see Polyclonal 0
1 ABIN1421116 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN1403245 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN1385781 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN6291751 IF WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN6028834 IF/ICC IHC IP WB Rabbit Log in to see Polyclonal 0
1 ABIN6020588 IF/ICC IHC IP WB Mouse Log in to see 0

General

Antigen Aminolevulinate, delta-, Synthase 1 (ALAS1) Antibodies
Epitope N-Term
(7), (4), (4), (4), (3), (2), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(70), (29), (29), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(59), (14)
Clonality
Polyclonal
Conjugate This ALAS1 antibody is un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(51), (16), (14), (13), (11), (10), (4), (4), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-ALAS1 Antibody

Target Details ALAS1 Application Details Handling Images
Specificity ALAS1 antibody was raised against the N terminal of ALAS1
Purification Affinity purified
Immunogen ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS
Plasmids, Primers & others

Target Details ALAS1

Product Details anti-ALAS1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ALAS1 (ALAS1 Antibody Abstract)
Background Delta-aminolevulinate synthase (ALAS, EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2.
Molecular Weight 70 kDa (MW of target protein)
Pathways Regulation of Lipid Metabolism by PPARalpha

Application Details

Product Details anti-ALAS1 Antibody Target Details ALAS1 Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ALAS1 Blocking Peptide, catalog no. 33R-2769, is also available for use as a blocking control in assays to test for specificity of this ALAS1 antibody

Restrictions For Research Use only

Handling

Product Details anti-ALAS1 Antibody Target Details ALAS1 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-ALAS1 Antibody Target Details ALAS1 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) (N-Term) antibody (ABIN631001) ALAS1 antibody used at 1 ug/ml to detect target protein.