anti-Human MED11 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MED11 Antibody (supplied by: Log in to see )

Antigen
Mediator Complex Subunit 11 (MED11) Antibodies
  • RGD1563202
  • MGC84174
  • 1110030J09Rik
  • AI465144
  • AW545069
  • RP23-42P20.8
  • mediator complex subunit 11
  • mediator of RNA polymerase II transcription, subunit 11 homolog (S. cerevisiae)
  • similar to S. cerevisiae RNA Pol II mediator complex component
  • Med11
  • med11
  • MED11
Reactivity
Human
3
3
3
3
3
Host
Rabbit
3
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
3
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4333400
Contact our Customer Service for availability and price in your country.

General

Antigen Mediator Complex Subunit 11 (MED11) Antibodies
Reactivity Human
(3), (3), (3), (3), (3)
Host Rabbit
(3)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(3)
Supplier Log in to see

Product Details anti-MED11 Antibody

Target Details MED11 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: YSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLE
Isotype IgG

Target Details MED11

Product Details anti-MED11 Antibody Application Details Handling Images back to top
Antigen
Alternative Name MED11 (MED11 Antibody Abstract)
Background Gene Symbol: MED11
Gene ID 400569
UniProt Q9P086
Pathways Regulation of Lipid Metabolism by PPARalpha

Application Details

Product Details anti-MED11 Antibody Target Details MED11 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MED11 Antibody Target Details MED11 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MED11 Antibody Target Details MED11 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mediator Complex Subunit 11 (MED11) antibody (ABIN4333400) Immunohistochemistry-Paraffin: MED11 Antibody [NBP2-34162] - liver cancer
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mediator Complex Subunit 11 (MED11) antibody (ABIN4333400) Immunohistochemistry-Paraffin: MED11 Antibody [NBP2-34162] - Immunohistochemical stai...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mediator Complex Subunit 11 (MED11) antibody (ABIN4333400) Immunohistochemistry-Paraffin: MED11 Antibody [NBP2-34162] - rectum
Immunofluorescence (IF) image for anti-Mediator Complex Subunit 11 (MED11) antibody (ABIN4333400) Immunocytochemistry/Immunofluorescence: MED11 Antibody [NBP2-34162] - Staining of hum...