anti-Mouse (Murine) Exportin 5 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Exportin 5 Antibody (supplied by: Log in to see )

Antigen
Exportin 5 (XPO5) Antibodies
  • exp5
  • CG12234
  • Dmel\\CG12234
  • Exp-5
  • Exp5
  • RanBP21
  • dmExp5
  • 2410004H11Rik
  • 2700038C24Rik
  • AI648907
  • AW549301
  • RanBp21
  • mKIAA1291
  • exportin-5
  • ranbp21
  • DDBDRAFT_0185980
  • DDBDRAFT_0237583
  • DDB_0185980
  • DDB_0237583
  • XPO5
  • exportin 5
  • CG12234 gene product from transcript CG12234-RB
  • armadillo-like helical domain-containing protein
  • XPO5
  • Ranbp21
  • Xpo5
  • xpo5
Reactivity
Human, Mouse (Murine), Rat (Rattus)
64
34
32
5
5
4
3
3
1
1
1
Host
Rabbit
58
7
Clonality
Polyclonal
Conjugate
Un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
53
18
13
11
11
7
5
4
3
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4309800
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.704311 ABIN4309801 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
11.704311 ABIN4309799 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1407872 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN1389979 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN1386464 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Exportin 5 (XPO5) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(64), (34), (32), (5), (5), (4), (3), (3), (1), (1), (1)
Host Rabbit
(58), (7)
Clonality
Polyclonal
Conjugate Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(53), (18), (13), (11), (11), (7), (5), (4), (3), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ILGPLFTYLHMRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDVCTALLITAFNSLAWKDTLSC
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name Exportin-5 (XPO5 Antibody Abstract)
Background Gene Symbol: XPO5
Molecular Weight Theoretical MW: 136 kDa
Gene ID 57510
UniProt Q9HAV4
Pathways Regulatory RNA Pathways, Protein targeting to Nucleus

Application Details

Product details Target Details Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Exportin 5 (XPO5) antibody (ABIN4309800) Western Blot: Exportin-5 Antibody [NBP1-89606] - Lane 1: NIH-3T3 cell lysate (Mouse e...
Immunofluorescence (IF) image for anti-Exportin 5 (XPO5) antibody (ABIN4309800) Immunocytochemistry/Immunofluorescence: Exportin-5 Antibody [NBP1-89606] - Staining o...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Exportin 5 (XPO5) antibody (ABIN4309800) Immunohistochemistry-Paraffin: Exportin-5 Antibody [NBP1-89606] - staining of human t...
Western Blotting (WB) image for anti-Exportin 5 (XPO5) antibody (ABIN4309800) Western Blot: Exportin-5 Antibody [NBP1-89606] - Lane 1: Marker [kDa] 230, 130, 95, 7...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Exportin 5 (XPO5) antibody (ABIN4309800) Immunohistochemistry-Paraffin: Exportin-5 Antibody - Staining in human testis and li...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Exportin 5 (XPO5) antibody (ABIN4309800) Immunohistochemistry-Paraffin: Exportin-5 Antibody - Staining of human liver shows l...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Exportin 5 (XPO5) antibody (ABIN4309800) Immunohistochemistry-Paraffin: Exportin-5 Antibody - Staining of human testis shows ...
Western Blotting (WB) image for anti-Exportin 5 (XPO5) antibody (ABIN4309800) Western Blot: Exportin-5 Antibody - Western blot analysis in Caco-2 cells transfecte...