anti-Dog (Canine) ASS1 antibody for Immunohistochemistry

Recommended ASS1 Antibody (supplied by: Log in to see )

Antigen
Argininosuccinate Synthase 1 (ASS1) Antibodies
  • ASS
  • CTLN1
  • AA408052
  • Ass-1
  • fold
  • ASSA
  • Ass
  • ass
  • zgc:92051
  • wu:fb95a04
  • wu:fc01e08
  • argininosuccinate synthase 1
  • argininosuccinate synthetase 1
  • argininosuccinate synthase 1 S homeolog
  • ASS1
  • Ass1
  • ass1.S
  • ass1
Epitope
N-Term
28
12
11
8
5
4
4
3
2
2
2
2
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
121
34
23
13
11
11
4
3
2
2
2
1
1
1
Host
Rabbit
62
33
27
Clonality
Polyclonal
Conjugate
This ASS1 antibody is un-conjugated
6
4
4
3
3
3
Application
Immunohistochemistry (IHC), Western Blotting (WB)
112
73
59
32
30
26
24
10
6
5
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN629706
$ 388.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
14.536543 ABIN2776769 IHC WB Rabbit C-Term Log in to see Polyclonal 2
13.036543 ABIN489997 ELISA IHC IHC (p) IP WB Goat AA 196-212 Log in to see Polyclonal 0
10.036543 ABIN2776768 IHC WB Rabbit N-Term Log in to see Polyclonal 1
7 ABIN320629 IHC IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal 0
4 ABIN5609721 ELISA IF IHC IP WB Biotin Goat Internal Region Log in to see Polyclonal 0
4 ABIN2561198 IF IP IHC ELISA WB Goat IgG Internal Region Log in to see Polyclonal 0

General

Antigen Argininosuccinate Synthase 1 (ASS1) Antibodies
Epitope N-Term
(28), (12), (11), (8), (5), (4), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
(121), (34), (23), (13), (11), (11), (4), (3), (2), (2), (2), (1), (1), (1)
Host Rabbit
(62), (33), (27)
Clonality
Polyclonal
Conjugate This ASS1 antibody is un-conjugated
(6), (4), (4), (3), (3), (3)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(112), (73), (59), (32), (30), (26), (24), (10), (6), (5), (1), (1)
Supplier Log in to see

Product Details anti-ASS1 Antibody

Target Details ASS1 Application Details Handling Images
Specificity ASS1 antibody was raised against the N terminal Of Ass
Purification Purified
Immunogen ASS1 antibody was raised using the N terminal Of Ass corresponding to a region with amino acids YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
Plasmids, Primers & others

Target Details ASS1

Product Details anti-ASS1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ASS1 (ASS1 Antibody Abstract)
Background ASS catalyzes the penultimate step of the arginine biosynthetic pathway.
Molecular Weight 45 kDa (MW of target protein)
Pathways Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin

Application Details

Product Details anti-ASS1 Antibody Target Details ASS1 Handling Images back to top
Application Notes WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ASS1 Blocking Peptide, catalog no. 33R-10240, is also available for use as a blocking control in assays to test for specificity of this ASS1 antibody

Restrictions For Research Use only

Handling

Product Details anti-ASS1 Antibody Target Details ASS1 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASS antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-ASS1 Antibody Target Details ASS1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Argininosuccinate Synthase 1 (ASS1) (N-Term) antibody (ABIN629706) ASS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Western Blotting (WB) image for anti-Argininosuccinate Synthase 1 (ASS1) (N-Term) antibody (ABIN629706) ASS1 antibody used at 2.5 ug/ml to detect target protein.