anti-Human Polypyrimidine Tract Binding Protein 2 antibody for Western Blotting

Recommended Polypyrimidine Tract Binding Protein 2 Antibody

Antigen
Polypyrimidine Tract Binding Protein 2 (PTBP2) Antibodies
  • PTB
  • PTBLP
  • brPTB
  • nPTB
  • nPTB5
  • nPTB6
  • nPTB7
  • nPTB8
  • Ptb2
  • PTBP2
  • im:7153495
  • ptbp2
  • si:ch211-160l17.2
  • wu:fa08f05
  • wu:fc05d10
  • zgc:113074
  • polypyrimidine tract binding protein 2
  • polypyrimidine tract binding protein 2b
  • polypyrimidine tract binding protein 2a
  • PTBP2
  • Ptbp2
  • ptbp2b
  • ptbp2a
Epitope
N-Term
10
5
4
2
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
49
26
24
5
4
4
4
3
3
3
1
1
1
Host
Rabbit
31
15
5
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
2
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
30
30
3
2
2
1
1
Options

Available images

Catalog No. ABIN629977
$ 369.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
17.39185 ABIN633535 WB Rabbit N-Term Polyclonal 0
17.39185 ABIN6146373 WB Rabbit Polyclonal 0
15.390624 ABIN566178 ELISA WB Mouse IgG1 kappa AA 1-532 2D10-B2 2
13.501226 ABIN2149974 ELISA WB Rabbit IgG Polyclonal 0
13 ABIN566177 ELISA WB Mouse AA 1-532 Polyclonal 6
10.890624 ABIN6264500 ELISA ICC IF IHC WB Rabbit IgG Polyclonal 0
10.890624 ABIN528334 IF ELISA WB Mouse IgG2a kappa AA 35-175 2B11 0
9.390624 ABIN2776545 WB Rabbit N-Term Polyclonal 1
5.8221116 ABIN4348343 IHC IHC (p) WB Rabbit IgG C-Term Polyclonal 0
4.8906236 ABIN2776546 WB Rabbit N-Term Polyclonal 1
4.8906236 ABIN1877081 IP WB Rabbit IgG Polyclonal 0
4.8906236 ABIN2466160 IHC ELISA WB Goat N-Term Polyclonal 0
4.8906236 ABIN2968559 WB Rabbit IgG Polyclonal 0
4.8906236 ABIN6570235 WB Rabbit IgG Polyclonal 0
4.8906236 ABIN2462292 ELISA WB Rabbit Polyclonal 0
4.8906236 ABIN6715360 WB Rabbit Polyclonal 0
4 ABIN6743032 WB Rabbit AA 107-156 Polyclonal 0
4 ABIN203072 WB Rabbit IgG N-Term Polyclonal 0
4 ABIN961333 ELISA WB Mouse IgG2a, kappa AA 35-176 2B11 0
1.8906237 ABIN6685956 WB Rabbit Polyclonal 0

General

Antigen Polypyrimidine Tract Binding Protein 2 (PTBP2) Antibodies
Epitope N-Term
(10), (5), (4), (2), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(49), (26), (24), (5), (4), (4), (4), (3), (3), (3), (1), (1), (1)
Host Rabbit
(31), (15), (5)
Clonality
Polyclonal
Conjugate Un-conjugated
(3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(30), (30), (3), (2), (2), (1), (1)
Supplier

Product details

Target Details Application Details Handling Images
Specificity PTBP2 antibody was raised against the N terminal of PTBP2
Purification Purified
Immunogen PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name PTBP2 (PTBP2 Antibody Abstract)
Background PTBP2 binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain.
Molecular Weight 40 kDa (MW of target protein)
Pathways Ribonucleoprotein Complex Subunit Organization

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PTBP2 Blocking Peptide, catalog no. 33R-5835, is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Polypyrimidine Tract Binding Protein 2 (PTBP2) (N-Term) antibody (ABIN629977) PTBP2 antibody used at 1.25 ug/ml to detect target protein.