anti-Mouse (Murine) Polypyrimidine Tract Binding Protein 2 antibody for Western Blotting

Recommended Polypyrimidine Tract Binding Protein 2 Antibody (supplied by: Log in to see )

Polypyrimidine Tract Binding Protein 2 (PTBP2) Antibodies
  • PTB
  • brPTB
  • nPTB
  • nPTB5
  • nPTB6
  • nPTB7
  • nPTB8
  • Ptb2
  • PTBP2
  • im:7153495
  • ptbp2
  • si:ch211-160l17.2
  • wu:fa08f05
  • wu:fc05d10
  • zgc:113074
  • polypyrimidine tract binding protein 2
  • polypyrimidine tract binding protein 2b
  • polypyrimidine tract binding protein 2a
  • PTBP2
  • Ptbp2
  • ptbp2b
  • ptbp2a
Human, Mouse (Murine), Rat (Rattus)
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN629977
$ 388.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.844006 ABIN6264500 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 0
9.344006 ABIN2776545 WB Rabbit N-Term Log in to see Polyclonal 1
7.72077 ABIN4348343 IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
4.8440056 ABIN2776546 WB Rabbit N-Term Log in to see Polyclonal 1
4.8440056 ABIN2968559 WB Rabbit IgG Log in to see Polyclonal 0
4.8440056 ABIN6570235 WB Rabbit IgG Log in to see Polyclonal 0
4.8440056 ABIN2462292 ELISA WB Rabbit Log in to see Polyclonal 0
4.8440056 ABIN6715360 WB Rabbit Log in to see Polyclonal 0
4 ABIN203072 WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN5661578 WB Rabbit Log in to see Polyclonal 0
1 ABIN6759533 WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2466161 ELISA WB Goat Internal Region Log in to see Polyclonal 0
1 ABIN646977 ELISA WB Goat Log in to see 0
1 ABIN1090460 ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2344506 ELISA WB Goat Log in to see Polyclonal 0
1 ABIN2920972 ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5872862 ELISA WB Rabbit IgG Log in to see Polyclonal 0


Antigen Polypyrimidine Tract Binding Protein 2 (PTBP2) Antibodies
Epitope N-Term
(10), (5), (4), (2), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(42), (19), (17), (5), (4), (4), (4), (3), (3), (3), (1), (1), (1)
Host Rabbit
(24), (15), (5)
Conjugate Un-conjugated
(2), (2), (2), (1), (1), (1)
Application Western Blotting (WB)
(30), (30), (3), (2), (2), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity PTBP2 antibody was raised against the N terminal of PTBP2
Purification Purified
Immunogen PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE

Target Details

Product details Application Details Handling Images back to top
Alternative Name PTBP2 (PTBP2 Antibody Abstract)
Background PTBP2 binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain.
Molecular Weight 40 kDa (MW of target protein)
Pathways Ribonucleoprotein Complex Subunit Organization

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

PTBP2 Blocking Peptide, catalog no. 33R-5835, is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody

Restrictions For Research Use only


Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Polypyrimidine Tract Binding Protein 2 (PTBP2) (N-Term) antibody (ABIN629977) PTBP2 antibody used at 1.25 ug/ml to detect target protein.