anti-Monkey BDNF antibody for Immunohistochemistry

Recommended BDNF Antibody (supplied by: Log in to see )

Brain-Derived Neurotrophic Factor (BDNF) Antibodies
  • ANON2
  • BULN2
  • bdnf-A
  • BDNF
  • bdnf
  • brain derived neurotrophic factor
  • brain-derived neurotrophic factor
  • brain-derived neurotrophic factor L homeolog
  • brain-derived neurotrophic factor S homeolog
  • BDNF
  • Bdnf
  • bdnf
  • bdnf.L
  • bdnf.S
Human, Monkey
This BDNF antibody is un-conjugated
Immunohistochemistry (IHC), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4892211
Contact our Customer Service for availability and price in your country.


Antigen Brain-Derived Neurotrophic Factor (BDNF) Antibodies
Reactivity Human, Monkey
(307), (134), (116), (18), (16), (13), (12), (6), (6), (5), (5), (4), (3), (3), (2), (2)
Host Rabbit
(224), (106), (11), (10), (9), (5)
Conjugate This BDNF antibody is un-conjugated
(31), (20), (13), (6), (6), (6), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(288), (153), (105), (70), (69), (55), (44), (13), (13), (10), (9), (4), (4), (2), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-BDNF Antibody

Target Details BDNF Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to BDNF(brain-derived neurotrophic factor) The peptide sequence was selected from the middle region of BDNF. Peptide sequence EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG.

Target Details BDNF

Product Details anti-BDNF Antibody Application Details Handling Images back to top
Alternative Name BDNF (BDNF Antibody Abstract)
Background Gene Symbol: BDNF
Gene ID 627
UniProt P23560
Pathways RTK Signaling, Synaptic Membrane, Feeding Behaviour, Dicarboxylic Acid Transport, Regulation of long-term Neuronal Synaptic Plasticity

Application Details

Product Details anti-BDNF Antibody Target Details BDNF Handling Images back to top
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:200- 1:500This is a rabbit polyclonal antibody against BDNF and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-BDNF Antibody Target Details BDNF Application Details Images back to top
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.


Product Details anti-BDNF Antibody Target Details BDNF Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Immunohistochemistry: BDNF Antibody [NBP1-59304] - Rhesus macaque spinal cord. Concen...
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - Fetal Liver lysates, Antibody Dilution: 0....
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates, Antibody Dilution...
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - Human Liver cell lysate, concentration 0.2...
Immunohistochemistry (IHC) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Immunohistochemistry: BDNF Antibody [NBP1-59304] - Ventral horn region of mouse spina...
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates.
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - Sample Tissue: Human ACHN Antibody Dilutio...