anti-Monkey BDNF antibody for Western Blotting

Recommended BDNF Antibody (supplied by: Log in to see )

Antigen
Brain-Derived Neurotrophic Factor (BDNF) Antibodies
  • ANON2
  • BULN2
  • bdnf-A
  • BDNF
  • bdnf
  • brain derived neurotrophic factor
  • brain-derived neurotrophic factor
  • brain-derived neurotrophic factor L homeolog
  • brain-derived neurotrophic factor S homeolog
  • BDNF
  • Bdnf
  • bdnf
  • bdnf.L
  • bdnf.S
Reactivity
Human, Monkey
348
148
146
25
17
17
17
7
7
6
6
6
5
3
3
2
Host
Rabbit
266
116
12
9
8
6
Clonality
Polyclonal
Conjugate
This BDNF antibody is un-conjugated
37
23
15
7
7
6
6
5
5
5
3
3
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
333
146
131
72
69
57
48
45
34
13
9
4
3
2
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4892211
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN320693 WB Rabbit IgG AA 146-195 Log in to see Polyclonal 0
1 ABIN602834 WB Rabbit IgG AA 162-176 Log in to see Polyclonal 0
1 ABIN326619 IHC IHC (fro) WB Rabbit AA 69-82 Log in to see Polyclonal 0
1 ABIN1834607 WB Rabbit AA 150-199 Log in to see Polyclonal 0
1 ABIN326614 WB Rabbit IgG AA 131-150 Log in to see Polyclonal 0

General

Antigen Brain-Derived Neurotrophic Factor (BDNF) Antibodies
Reactivity Human, Monkey
(348), (148), (146), (25), (17), (17), (17), (7), (7), (6), (6), (6), (5), (3), (3), (2)
Host Rabbit
(266), (116), (12), (9), (8), (6)
Clonality
Polyclonal
Conjugate This BDNF antibody is un-conjugated
(37), (23), (15), (7), (7), (6), (6), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(333), (146), (131), (72), (69), (57), (48), (45), (34), (13), (9), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-BDNF Antibody

Target Details BDNF Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to BDNF(brain-derived neurotrophic factor) The peptide sequence was selected from the middle region of BDNF. Peptide sequence EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG.
Plasmids, Primers & others

Target Details BDNF

Product Details anti-BDNF Antibody Application Details Handling Images back to top
Antigen
Alternative Name BDNF (BDNF Antibody Abstract)
Background Gene Symbol: BDNF
Gene ID 627
UniProt P23560
Pathways RTK Signaling, Synaptic Membrane, Feeding Behaviour, Dicarboxylic Acid Transport, Regulation of long-term Neuronal Synaptic Plasticity

Application Details

Product Details anti-BDNF Antibody Target Details BDNF Handling Images back to top
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:200- 1:500This is a rabbit polyclonal antibody against BDNF and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-BDNF Antibody Target Details BDNF Application Details Images back to top
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

Images

Product Details anti-BDNF Antibody Target Details BDNF Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Immunohistochemistry: BDNF Antibody [NBP1-59304] - Rhesus macaque spinal cord. Concen...
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - Fetal Liver lysates, Antibody Dilution: 0....
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates, Antibody Dilution...
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - Human Liver cell lysate, concentration 0.2...
Immunohistochemistry (IHC) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Immunohistochemistry: BDNF Antibody [NBP1-59304] - Ventral horn region of mouse spina...
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates.
Western Blotting (WB) image for anti-Brain-Derived Neurotrophic Factor (BDNF) antibody (ABIN4892211) Western Blot: BDNF Antibody [NBP1-59304] - Sample Tissue: Human ACHN Antibody Dilutio...