anti-Human EPGN antibody for Immunofluorescence

Recommended EPGN Antibody (supplied by: Log in to see )

Epithelial Mitogen Homolog (Mouse) (EPGN) Antibodies
  • ALGV3072
  • EPG
  • PRO9904
  • 2310069M11Rik
  • epigen
  • RGD1560084
  • epithelial mitogen
  • EPGN
  • Epgn
This EPGN antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5076553
Contact our Customer Service for availability and price in your country.


Antigen Epithelial Mitogen Homolog (Mouse) (EPGN) Antibodies
Reactivity Human
(46), (34), (20)
Host Rabbit
(47), (15), (1)
Conjugate This EPGN antibody is un-conjugated
(4), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(50), (21), (18), (13), (3), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-EPGN Antibody

Target Details EPGN Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYE
Isotype IgG

Target Details EPGN

Product Details anti-EPGN Antibody Application Details Handling Images back to top
Alternative Name EPGN (EPGN Antibody Abstract)
Background Gene Symbol: EPGN
Gene ID 255324
Pathways RTK Signaling, EGFR Signaling Pathway

Application Details

Product Details anti-EPGN Antibody Target Details EPGN Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-EPGN Antibody Target Details EPGN Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-EPGN Antibody Target Details EPGN Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Epithelial Mitogen Homolog (Mouse) (EPGN) antibody (ABIN5076553) Immunocytochemistry/Immunofluorescence: EPGN Antibody - Staining of human cell line ...