anti-Human FGFR4 antibody for Immunofluorescence

Recommended FGFR4 Antibody (supplied by: Log in to see )

Fibroblast Growth Factor Receptor 4 (FGFR4) Antibodies
  • FGFR4
  • XFGFR-4
  • XFGFR-4a
  • cd334
  • fgfr-4
  • jtk2
  • tkf
  • xfgfr4
  • CD334
  • JTK2
  • TKF
  • Fgfr-4
  • etID309818.21
  • wu:fc13h10
  • zgc:111935
  • fgfr-4c
  • fgfr4
  • fibroblast growth factor receptor 4
  • fibroblast growth factor receptor 4 S homeolog
  • FGFR4
  • fgfr4
  • Fgfr4
  • fgfr4.S
This FGFR4 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4311567
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.57848 ABIN4311568 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
10.57848 ABIN3030958 FACS IF IHC ELISA WB Rabbit Ig Fraction AA 24-55 Log in to see Polyclonal 0
10.57848 ABIN931414 IF ELISA WB Mouse IgG1 Log in to see 7H1 0
10.57848 ABIN1106283 EIA IF WB Mouse IgG1 Log in to see 7H1 0
1 ABIN391970 FACS IF IHC (p) WB Rabbit Ig Fraction AA 24-55, N-Term Log in to see Polyclonal 1
1 ABIN466715 IF ELISA WB Mouse IgG1 Log in to see 7H1 0
1 ABIN5531164 FACS IF IHC (p) WB Rabbit Ig Fraction AA 24-55, N-Term Log in to see Polyclonal 0
1 ABIN4901533 ELISA IF WB Mouse IgG1 Log in to see 7H1 0
1 ABIN2661052 FACS IF Biotin Mouse IgG1 kappa Log in to see 4FR6D3 4
1 ABIN966141 IF ELISA WB Mouse IgG1 Extracellular Log in to see 7H1 2
1 ABIN5578118 ELISA IF WB Mouse IgG1 Log in to see 7H1 0
1 ABIN5578119 IF IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5578120 IF IHC (p) Rabbit IgG Log in to see Polyclonal 0
1 ABIN1895805 ELISA FACS IF IHC WB Alkaline Phosphatase (AP) Rabbit IgG AA 24-55 Log in to see Polyclonal 0
1 ABIN1895807 ELISA FACS IF IHC WB Biotin Rabbit IgG AA 24-55 Log in to see Polyclonal 0
1 ABIN1895809 ELISA FACS IF IHC WB PE Rabbit IgG AA 24-55 Log in to see Polyclonal 0
1 ABIN1895806 ELISA FACS IF IHC WB APC Rabbit IgG AA 24-55 Log in to see Polyclonal 0
1 ABIN1895810 ELISA FACS IF IHC WB HRP Rabbit IgG AA 24-55 Log in to see Polyclonal 0
1 ABIN2620880 FACS IF IHC WB Rabbit IgG AA 24-55 Log in to see Polyclonal 0
1 ABIN1840505 FACS IF IHC IHC (p) WB Rabbit AA 24-55 Log in to see Polyclonal 0


Antigen Fibroblast Growth Factor Receptor 4 (FGFR4) Antibodies
Reactivity Human
(195), (63), (54), (3), (3)
Host Rabbit
(133), (67), (10)
Conjugate This FGFR4 antibody is un-conjugated
(9), (8), (7), (5), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(163), (104), (58), (34), (31), (25), (13), (10), (7), (7), (5), (3), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-FGFR4 Antibody

Target Details FGFR4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGN
Isotype IgG
Plasmids, Primers & others

Target Details FGFR4

Product Details anti-FGFR4 Antibody Application Details Handling Images back to top
Alternative Name FGF R4 (FGFR4 Antibody Abstract)
Background Gene Symbol: FGFR4
Gene ID 2264
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Carbohydrate Homeostasis, Growth Factor Binding

Application Details

Product Details anti-FGFR4 Antibody Target Details FGFR4 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-FGFR4 Antibody Target Details FGFR4 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-FGFR4 Antibody Target Details FGFR4 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Fibroblast Growth Factor Receptor 4 (FGFR4) antibody (ABIN4311567) Immunocytochemistry/Immunofluorescence: FGFR4 Antibody [NBP1-84586] Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Fibroblast Growth Factor Receptor 4 (FGFR4) antibody (ABIN4311567) Immunohistochemistry-Paraffin: FGFR4 Antibody [NBP1-84586] - Staining of human liver ...