anti-Human HER2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended HER2 Antibody (supplied by: Log in to see )

Antigen
V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) Antibodies
  • CD340
  • HER-2
  • HER-2/neu
  • HER2
  • MLN 19
  • NEU
  • NGL
  • TKR1
  • Erbb-2
  • Neu
  • c-erbB2
  • c-neu
  • mKIAA3023
  • wu:fv70f10
  • zgc:63601
  • erb2
  • erb-b2 receptor tyrosine kinase 2
  • ERBB2
  • Erbb2
  • erbb2
Reactivity
Human
1323
412
314
30
22
10
6
6
6
4
4
3
3
3
3
3
2
2
2
2
1
1
1
Host
Rabbit
794
591
29
16
10
3
3
Clonality
Polyclonal
Conjugate
This HER2 antibody is un-conjugated
59
45
44
42
41
27
20
20
13
13
13
13
11
11
8
8
8
8
8
7
7
7
7
7
7
7
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
3
2
2
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
679
469
435
408
350
195
192
102
100
100
94
47
24
21
18
11
6
3
3
3
2
2
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4309125
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.879798 ABIN4309121 ICC IF IHC IHC (p) WB Rabbit pTyr1248 Log in to see Polyclonal 2
10.879798 ABIN305740 IHC IHC (fro) IHC (p) IP WB Rabbit IgG AA 1243-1255 Log in to see Polyclonal 0
10.879798 ABIN4960167 IHC IHC (p) WB Mouse IgG1 Log in to see CL0268 0
10.879798 ABIN213613 IHC IHC (p) Rabbit Cytoplasmic Domain Log in to see Polyclonal 0
10.879798 ABIN295912 ICC IHC IHC (p) WB Chicken IgY AA 153-433 Log in to see Polyclonal 0
10.879798 ABIN151232 IHC (p) IP IHC WB Rabbit AA 975-1025 Log in to see Polyclonal 1
10.879798 ABIN4309139 FACS IF IHC (p) WB Mouse IgG1 kappa Log in to see HRB2-451 0
10.879798 ABIN725345 IF (p) IHC (p) Rabbit IgG AA 1210-1255 Log in to see Polyclonal 0
10.879798 ABIN498415 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
10.879798 ABIN4309126 FACS ICC IF IHC IHC (p) WB Mouse IgG2a Log in to see 4F10 0
10.879798 ABIN498847 IHC (p) Rabbit pTyr1248 Log in to see Polyclonal 0
10.879798 ABIN498846 IHC (p) Rabbit pTyr877 Log in to see Polyclonal 0
10.879798 ABIN498935 IHC (p) Rabbit Log in to see Polyclonal 0
10.879798 ABIN498936 IHC (p) Rabbit Log in to see Polyclonal 0
1 ABIN391947 IHC (p) WB Rabbit Ig Fraction AA 1227-1255, C-Term, Tyr1248 Log in to see Polyclonal 4
1 ABIN391948 FACS IF IHC (p) WB Rabbit Ig Fraction Log in to see Polyclonal 4
1 ABIN391945 FACS IHC (p) WB Rabbit Ig Fraction AA 21-52, N-Term Log in to see Polyclonal 4
1 ABIN5518830 IHC (p) WB Rabbit IgG AA 29-64, N-Term Log in to see Polyclonal 0
1 ABIN4309119 ICC IF IHC IHC (p) WB Rabbit pTyr877 Log in to see Polyclonal 1
1 ABIN4309120 IHC IHC (p) IP WB Rabbit pTyr877 Log in to see Polyclonal 1

General

Antigen V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) Antibodies
Reactivity Human
(1323), (412), (314), (30), (22), (10), (6), (6), (6), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(794), (591), (29), (16), (10), (3), (3)
Clonality
Polyclonal
Conjugate This HER2 antibody is un-conjugated
(59), (45), (44), (42), (41), (27), (20), (20), (13), (13), (13), (13), (11), (11), (8), (8), (8), (8), (8), (7), (7), (7), (7), (7), (7), (7), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (3), (2), (2), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(679), (469), (435), (408), (350), (195), (192), (102), (100), (100), (94), (47), (24), (21), (18), (11), (6), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-HER2 Antibody

Target Details HER2 Application Details Handling References for anti-HER2 antibody (ABIN4309125) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Isotype IgG
Plasmids, Primers & others

Target Details HER2

Product Details anti-HER2 Antibody Application Details Handling References for anti-HER2 antibody (ABIN4309125) Images back to top
Antigen
Alternative Name ErbB2/Her2 (ERBB2 Antibody Abstract)
Background Gene Symbol: ERBB2
Gene ID 2064
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Skeletal Muscle Fiber Development

Application Details

Product Details anti-HER2 Antibody Target Details HER2 Handling References for anti-HER2 antibody (ABIN4309125) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-HER2 Antibody Target Details HER2 Application Details References for anti-HER2 antibody (ABIN4309125) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-HER2 antibody (ABIN4309125)

Product Details anti-HER2 Antibody Target Details HER2 Application Details Handling Images back to top
Product cited in:

Newie, Søkilde, Persson, Grabau, Rego, Kvist, von Stedingk, Axelson, Borg, Vallon-Christersson, Rovira: "The HER2-encoded miR-4728-3p regulates ESR1 through a non-canonical internal seed interaction." in: PLoS ONE, Vol. 9, Issue 5, pp. e97200, 2014 (Sample species: Human). Further details: Western Blotting

Huvila, Talve, Carpén, Edqvist, Pontén, Grénman, Auranen: "Progesterone receptor negativity is an independent risk factor for relapse in patients with early stage endometrioid endometrial adenocarcinoma." in: Gynecologic oncology, Vol. 130, Issue 3, pp. 463-9, 2013

Images

Product Details anti-HER2 Antibody Target Details HER2 Application Details Handling References for anti-HER2 antibody (ABIN4309125) back to top
Supplier Images
Western Blotting (WB) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) antibody (ABIN4309125) Western Blot: ErbB2/Her2 Antibody [NBP1-84584] - Lane 1: Marker [kDa] 206, 113, 82, 4...
Immunofluorescence (IF) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) antibody (ABIN4309125) Immunocytochemistry/Immunofluorescence: ErbB2/Her2 Antibody [NBP1-84584] - Staining o...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) antibody (ABIN4309125) Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human u...
Immunofluorescence (IF) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) antibody (ABIN4309125) Immunocytochemistry/Immunofluorescence: ErbB2/Her2 Antibody - Immunofluorescent stai...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) antibody (ABIN4309125) Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody - Staining of human breast cancer...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-V-Erb-B2 erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/glioblastoma Derived Oncogene Homolog (Avian) (ERBB2) antibody (ABIN4309125) Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody - Staining of human breast cancer...