anti-Human NFAT1 antibody for Immunocytochemistry

Recommended NFAT1 Antibody (supplied by: Log in to see )

Antigen
Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 (NFAT1) Antibodies
  • NFATC2
  • AI607462
  • NF-ATc2
  • NFAT1
  • NFAT1-D
  • Nfatp
  • NFATP
  • nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
  • nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 2
  • NFATC2
  • nfatc2
  • Nfatc2
Reactivity
Human
150
87
80
12
8
8
6
6
6
5
1
1
1
Host
Rabbit
109
26
19
Clonality
Polyclonal
Conjugate
This NFAT1 antibody is un-conjugated
6
6
6
4
4
4
3
3
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
92
55
39
34
20
19
19
17
16
10
4
2
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4339295
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN152663 ChIP ELISA GS ICC IF IHC (fro) IHC (p) IP WB Mouse IgG1 Log in to see 25A10-D6-D2 8
1 ABIN4339305 ELISA ICC IF IHC (fro) IHC (p) WB DyLight 680 Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339298 ELISA ICC IF IHC (fro) IHC (p) WB DyLight 405 Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339302 ELISA ICC IF IHC (fro) IHC (p) WB DyLight 755 Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339303 ELISA ICC IF IHC (fro) IHC (p) WB DyLight 488 Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339306 ELISA ICC IF IHC (fro) IHC (p) WB Alexa Fluor 405 Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339307 ELISA ICC IF IHC (fro) IHC (p) WB Alexa Fluor 488 Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339308 ELISA ICC IF IHC (fro) IHC (p) WB Alexa Fluor 647 Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339297 ELISA ICC IF IHC (fro) IHC (p) WB DyLight 350 Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339300 GS ICC IF IHC IHC (p) IP WB PerCP Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339309 ELISA ICC IF IHC (fro) IHC (p) WB Alexa Fluor 700 Mouse IgG1 Log in to see 25A10-D6-D2
1 ABIN4339301 GS ICC IF IHC IHC (p) IP WB Allophycocyanin Mouse IgG1 AA 51-69 Log in to see 25A10-D6-D2
1 ABIN4339299 GS ICC IF IHC IHC (p) IP WB PE Mouse IgG1 AA 51-69 Log in to see 25A10-D6-D2
1 ABIN1869443 ICC IHC IP WB Rabbit IgG AA 392-574 Log in to see Polyclonal
1 ABIN2586086 ChIP ICC IHC IP WB Rabbit Log in to see Polyclonal
1 ABIN2745548 ICC IP IHC WB Rabbit full length Log in to see Polyclonal
1 ABIN2963578 ICC IP IHC WB Rabbit full length Log in to see Polyclonal

General

Antigen Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 (NFAT1) Antibodies
Reactivity Human
(150), (87), (80), (12), (8), (8), (6), (6), (6), (5), (1), (1), (1)
Host Rabbit
(109), (26), (19)
Clonality
Polyclonal
Conjugate This NFAT1 antibody is un-conjugated
(6), (6), (6), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(92), (55), (39), (34), (20), (19), (19), (17), (16), (10), (4), (2), (2), (2), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-NFAT1 Antibody

Target Details NFAT1 Application Details Handling References for anti-NFAT1 antibody (ABIN4339295) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN
Isotype IgG

Target Details NFAT1

Product Details anti-NFAT1 Antibody Application Details Handling References for anti-NFAT1 antibody (ABIN4339295) Images back to top
Antigen
Alternative Name NFATC2/NFAT1 (NFAT1 Antibody Abstract)
Background Gene Symbol: NFATC2
Gene ID 4773
Pathways RTK Signaling, WNT Signaling, Fc-epsilon Receptor Signaling Pathway, VEGF Signaling

Application Details

Product Details anti-NFAT1 Antibody Target Details NFAT1 Handling References for anti-NFAT1 antibody (ABIN4339295) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-NFAT1 Antibody Target Details NFAT1 Application Details References for anti-NFAT1 antibody (ABIN4339295) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-NFAT1 antibody (ABIN4339295)

Product Details anti-NFAT1 Antibody Target Details NFAT1 Application Details Handling Images back to top
Product cited in:

Perotti, Baldassari, Molla, Vegetti, Bersani, Maurichi, Santinami, Anichini, Mortarini: "NFATc2 is an intrinsic regulator of melanoma dedifferentiation." in: Oncogene, Vol. 35, Issue 22, pp. 2862-72, 2016 (Sample species: Human). Further details: Immunohistochemistry

Images

Product Details anti-NFAT1 Antibody Target Details NFAT1 Application Details Handling References for anti-NFAT1 antibody (ABIN4339295) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 (NFAT1) antibody (ABIN4339295) Immunocytochemistry/Immunofluorescence: NFAT1 Antibody [NBP1-82582] Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 (NFAT1) antibody (ABIN4339295) Immunohistochemistry-Paraffin: NFAT1 Antibody [NBP1-82582] - Staining of human testis...
Immunocytochemistry (ICC) image for anti-Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 (NFAT1) antibody (ABIN4339295) Immunohistochemistry: NFATC2/NFAT1 Antibody - Staining of human lymph node shows mod...