anti-Human PDGFB antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PDGFB Antibody (supplied by: Log in to see )

Antigen
Platelet-Derived Growth Factor beta Polypeptide (PDGFB) Antibodies
  • PDGF-2
  • PDGF2
  • SIS
  • SSV
  • c-sis
  • pdgf2
  • sis
  • si:ch211-79m20.1
  • si:dkey-261d11.1
  • PDGF-B
  • Sis
  • platelet derived growth factor subunit B
  • platelet-derived growth factor beta polypeptide
  • platelet derived growth factor subunit B S homeolog
  • platelet-derived growth factor beta polypeptide a
  • platelet derived growth factor, B polypeptide
  • PDGFB
  • pdgfb.S
  • pdgfba
  • Pdgfb
Reactivity
Human
103
64
45
3
3
3
1
Host
Rabbit
98
22
5
3
Clonality
Polyclonal
Conjugate
This PDGFB antibody is un-conjugated
7
5
4
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
101
41
31
27
16
13
6
6
3
2
2
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344540
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.828831 ABIN725990 IF (p) IHC (p) WB Rabbit IgG AA 140-190 Log in to see Polyclonal 4
12.828831 ABIN258832 CyTOF FACS IHC IHC (p) WB Mouse IgG1 Log in to see MM0014-5F66 1
12.828831 ABIN615518 IHC (p) Goat C-Term Log in to see Polyclonal 0
12.828831 ABIN4344538 IHC (p) Goat C-Term Log in to see Polyclonal 1
12.828831 ABIN4344541 IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
12.828831 ABIN4344539 IHC IHC (p) WB Rabbit Isoform B, N-Term Log in to see Polyclonal 0
1 ABIN2854834 IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN115467 IHC (fro) IHC (p) Rabbit AA 101-116 Log in to see Polyclonal 3
1 ABIN271781 IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN1737934 IHC (p) Goat C-Term Log in to see Polyclonal 0
1 ABIN116211 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal 1
1 ABIN115468 IHC (fro) IHC (p) Rabbit AA 101-116 Log in to see Polyclonal 1
1 ABIN116212 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal 1
1 ABIN725999 IHC (p) WB HRP Rabbit IgG AA 140-190 Log in to see Polyclonal 0
1 ABIN725992 IHC (p) WB Biotin Rabbit IgG AA 140-190 Log in to see Polyclonal 0
1 ABIN5606939 FACS IHC IHC (p) WB Alexa Fluor 700 Mouse IgG1 Log in to see MM0014-5F66 0
1 ABIN5606936 FACS IHC IHC (p) WB Alexa Fluor 405 Mouse IgG1 Log in to see MM0014-5F66 0
1 ABIN5606937 FACS IHC IHC (p) WB Alexa Fluor 488 Mouse IgG1 Log in to see MM0014-5F66 0
1 ABIN5606938 FACS IHC IHC (p) WB Alexa Fluor 647 Mouse IgG1 Log in to see MM0014-5F66 0
1 ABIN5606942 FACS IHC IHC (p) WB DyLight 350 Mouse IgG1 Log in to see MM0014-5F66 0

General

Antigen Platelet-Derived Growth Factor beta Polypeptide (PDGFB) Antibodies
Reactivity Human
(103), (64), (45), (3), (3), (3), (1)
Host Rabbit
(98), (22), (5), (3)
Clonality
Polyclonal
Conjugate This PDGFB antibody is un-conjugated
(7), (5), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(101), (41), (31), (27), (16), (13), (6), (6), (3), (2), (2), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PDGFB Antibody

Target Details PDGFB Application Details Handling References for anti-PDGFB antibody (ABIN4344540) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIV
Isotype IgG

Target Details PDGFB

Product Details anti-PDGFB Antibody Application Details Handling References for anti-PDGFB antibody (ABIN4344540) Images back to top
Antigen
Alternative Name PDGF-B (PDGFB Antibody Abstract)
Background Gene Symbol: PDGFB
Gene ID 5155
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling

Application Details

Product Details anti-PDGFB Antibody Target Details PDGFB Handling References for anti-PDGFB antibody (ABIN4344540) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50Immunohistochemistry retrieval method recommended:HIER pH 6
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PDGFB Antibody Target Details PDGFB Application Details References for anti-PDGFB antibody (ABIN4344540) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PDGFB antibody (ABIN4344540)

Product Details anti-PDGFB Antibody Target Details PDGFB Application Details Handling Images back to top
Product cited in:

Hartleben, Widmeier, Suhm, Worthmann, Schell, Helmstädter, Wiech, Walz, Leitges, Schiffer, Huber: "aPKCλ/ι and aPKCζ contribute to podocyte differentiation and glomerular maturation." in: Journal of the American Society of Nephrology : JASN, Vol. 24, Issue 2, pp. 253-67, 2013

Images

Product Details anti-PDGFB Antibody Target Details PDGFB Application Details Handling References for anti-PDGFB antibody (ABIN4344540) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Platelet-Derived Growth Factor beta Polypeptide (PDGFB) antibody (ABIN4344540) Immunohistochemistry-Paraffin: PDGFB Antibody [NBP1-87036] - Staining of human latera...
Western Blotting (WB) image for anti-Platelet-Derived Growth Factor beta Polypeptide (PDGFB) antibody (ABIN4344540) Western Blot: PDGFB Antibody [NBP1-87036] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Western Blotting (WB) image for anti-Platelet-Derived Growth Factor beta Polypeptide (PDGFB) antibody (ABIN4344540) Western Blot: PDGF-B Antibody - Analysis in human cell line SK-BR-3.
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Platelet-Derived Growth Factor beta Polypeptide (PDGFB) antibody (ABIN4344540) Immunohistochemistry-Paraffin: PDGF-B Antibody - Staining of human liver shows weak ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Platelet-Derived Growth Factor beta Polypeptide (PDGFB) antibody (ABIN4344540) Immunohistochemistry-Paraffin: PDGF-B Antibody - Staining of human cerebral cortex s...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Platelet-Derived Growth Factor beta Polypeptide (PDGFB) antibody (ABIN4344540) Immunohistochemistry-Paraffin: PDGF-B Antibody - Staining of human lung shows modera...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Platelet-Derived Growth Factor beta Polypeptide (PDGFB) antibody (ABIN4344540) Immunohistochemistry-Paraffin: PDGF-B Antibody - Staining of human placenta shows mo...
Immunofluorescence (IF) image for anti-Platelet-Derived Growth Factor beta Polypeptide (PDGFB) antibody (ABIN4344540) Immunocytochemistry/Immunofluorescence: PDGF-B Antibody - Staining of human cell lin...