anti-Mouse (Murine) PDGFRA antibody for Western Blotting

Recommended PDGFRA Antibody (supplied by: Log in to see )

Platelet-Derived Growth Factor Receptor, alpha Polypeptide (PDGFRA) Antibodies
  • AI115593
  • CD140a
  • Pdgfr-2
  • CD140A
  • PDGFR-2
  • PDGFR2
  • platelet derived growth factor receptor alpha
  • platelet derived growth factor receptor, alpha polypeptide
  • platelet-derived growth factor receptor, alpha polypeptide L homeolog
  • platelet-derived growth factor receptor, alpha polypeptide
  • Pdgfra
  • pdgfra.L
AA 968-1002, C-Term
Human, Mouse (Murine), Rat (Rattus)
This PDGFRA antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043897
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.185168 ABIN2705108 IC IF WB Rabbit C-Term Log in to see Polyclonal 0
3.185168 ABIN1532090 ELISA WB Rabbit IgG AA 816-865, pTyr849 Log in to see Polyclonal 2
3.185168 ABIN1533127 ELISA WB Rabbit IgG AA 816-865 Log in to see Polyclonal 2
3.185168 ABIN446762 ICC IF IHC (p) IHC WB Rabbit Log in to see Polyclonal 2
3.185168 ABIN1585011 ELISA WB Rabbit C-Term Log in to see Polyclonal 0
3.185168 ABIN1533378 IF IHC ELISA WB Rabbit IgG AA 1031-1080 Log in to see Polyclonal 0
3.185168 ABIN392022 FACS IHC (p) WB Rabbit Ig Fraction AA 1048-1077, C-Term Log in to see Polyclonal 1
3.185168 ABIN271391 WB Rabbit pTyr742 Log in to see Polyclonal 3
3.185168 ABIN658175 WB Rabbit Ig Fraction AA 678-706, Center Log in to see Polyclonal 0
3.185168 ABIN499026 WB Rabbit Log in to see Polyclonal 0
3.185168 ABIN498160 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
3.185168 ABIN1874075 IHC WB Rabbit IgG Log in to see Polyclonal 0
3.185168 ABIN1845906 WB Rabbit pTyr849 Log in to see Polyclonal 0
3.185168 ABIN3187792 ELISA IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal 0
3.185168 ABIN3186367 ELISA IF IHC WB Rabbit IgG C-Term Log in to see Polyclonal 0
3.185168 ABIN3182336 ELISA IHC WB Rabbit IgG pTyr849 Log in to see Polyclonal 0
3.185168 ABIN1845908 WB Rabbit Log in to see Polyclonal 0
3.185168 ABIN2564440 WB Rabbit IgG pTyr849 Log in to see Polyclonal 0
3.185168 ABIN2564439 WB Rabbit IgG pTyr754 Log in to see Polyclonal 0
3.185168 ABIN2564441 WB Rabbit IgG pTyr1018 Log in to see Polyclonal 0


Antigen Platelet-Derived Growth Factor Receptor, alpha Polypeptide (PDGFRA) Antibodies
Epitope AA 968-1002, C-Term
(41), (21), (19), (19), (18), (18), (18), (18), (15), (15), (15), (15), (14), (13), (11), (11), (11), (10), (10), (10), (7), (7), (6), (5), (5), (5), (5), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(503), (269), (174), (6), (6), (6), (5), (5), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(365), (164), (53), (3), (1)
Conjugate This PDGFRA antibody is un-conjugated
(37), (32), (32), (28), (23), (14), (13), (12), (7), (7), (7), (7), (6), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (4), (4), (3), (3), (3), (2), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(349), (227), (212), (146), (112), (67), (53), (49), (17), (15), (15), (14), (9), (4), (3), (3), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-PDGFRA Antibody

Target Details PDGFRA Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Platelet-derived growth factor receptor alpha(PDGFRA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Platelet-derived growth factor receptor alpha(PDGFRA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: platelet-derived growth factor receptor, alpha polypeptide
Protein Name: Platelet-derived growth factor receptor alpha
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human PDGFRA (968-1002aa DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Isotype IgG

Target Details PDGFRA

Product Details anti-PDGFRA Antibody Application Details Handling Images back to top
Alternative Name PDGFRA (PDGFRA Antibody Abstract)
Background PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The PDGFA gene is mapped on 4q12. The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib. And the PDGFRA gene contains 23 exons spanning about 65 kb. Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al. showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells. PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family. Lei et al. noted that in the rabbit model of the disease, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB. PDGFRA is a critical receptor required for human CMV infection, and thus a target for novel antiviral therapies.

Synonyms: Alpha platelet derived growth factor receptor antibody|Alpha-type platelet-derived growth factor receptor antibody|CD 140a antibody| CD140 antigen-like family member A antibody| CD140a antibody|CD140a antigen antibody|MGC74795 antibody|PDGF alpha chain antibody|PDGF R alpha antibody|PDGF-R-alpha antibody|PDGFR 2 antibody|PDGFR A antibody|PDGFR alpha antibody|PDGFR2 antibody|PDGFRA antibody| PDGFRA/BCR fusion antibody|PGFRA_HUMAN antibody|Platelet derived growth factor receptor 2 antibody|Platelet derived growth factor receptor alpha antibody|Platelet derived growth factor receptor alpha polypeptide antibody|Platelet derived growth factor receptor antibody|Rearranged in hypereosinophilia platelet derived growth factor receptor alpha fusion protein antibody|RHEPDGFRA antibody
Gene ID 5156
UniProt P16234
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Platelet-derived growth Factor Receptor Signaling

Application Details

Product Details anti-PDGFRA Antibody Target Details PDGFRA Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only


Product Details anti-PDGFRA Antibody Target Details PDGFRA Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-PDGFRA Antibody Target Details PDGFRA Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Platelet-Derived Growth Factor Receptor, alpha Polypeptide (PDGFRA) (AA 968-1002), (C-Term) antibody (ABIN3043897) Anti- PDGFRA Picoband antibody, IHC(P) IHC(P): Human Intestinal Cancer Tissue
Western Blotting (WB) image for anti-Platelet-Derived Growth Factor Receptor, alpha Polypeptide (PDGFRA) (AA 968-1002), (C-Term) antibody (ABIN3043897) anti-Platelet-Derived Growth Factor Receptor, alpha Polypeptide (PDGFRA) (AA 968-1002), (C-Term) antibody (Image 2)