anti-Human Ret Proto-Oncogene antibody for Immunofluorescence

Recommended Ret Proto-Oncogene Antibody (supplied by: Log in to see )

Antigen
Ret Proto-Oncogene (RET) Antibodies
  • c-ret
  • cret
  • etID315074.13
  • ret1
  • wu:fd13h01
  • X-ret
  • ret-A
  • xret
  • RET
  • MTC1
  • CDHF12
  • CDHR16
  • HSCR1
  • MEN2A
  • MEN2B
  • PTC
  • RET-ELE1
  • RET51
  • RET9
  • c-Ret
  • ret proto-oncogene receptor tyrosine kinase
  • ret proto-oncogene S homeolog
  • ret proto-oncogene
  • ret
  • ret.S
  • RET
  • Ret
Reactivity
Human
389
126
116
10
3
2
2
2
2
1
1
1
1
1
1
1
Host
Rabbit
256
134
2
2
1
1
Clonality
Polyclonal
Conjugate
This Ret Proto-Oncogene antibody is un-conjugated
16
15
15
12
10
9
8
8
7
7
7
5
5
5
5
5
5
3
3
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
288
152
127
81
65
47
28
7
7
6
6
3
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4350058
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.155504 ABIN2705183 IC IF IHC WB Rabbit C-Term Log in to see Polyclonal 0
12.155504 ABIN2705182 IC IF IHC WB Rabbit C-Term, pTyr1062 Log in to see Polyclonal 0
12.155504 ABIN2705184 IC IF IHC WB Rabbit C-Term Log in to see Polyclonal 0
12.155504 ABIN659065 IF IHC (p) WB Mouse IgM, kappa Log in to see 188CT11-2-3 3
12.155504 ABIN1450227 IF ELISA WB Chicken IgY Log in to see Polyclonal 0
12.155504 ABIN4350067 ICC IF IHC (p) WB Mouse IgM kappa Log in to see 188CT11-2-3 0
12.155504 ABIN3032459 IF IHC ELISA WB Mouse IgM, kappa Log in to see 188CT11-2-3 0
1 ABIN1450578 IF IHC ELISA WB Rabbit IgG AA 881-930 Log in to see Polyclonal 2
1 ABIN3186734 ELISA IF IHC WB Rabbit IgG Thr77 Log in to see Polyclonal 0
1 ABIN1500667 IF IHC IHC (p) WB Mouse IgM, kappa Log in to see 0
1 ABIN1450308 IF IHC ELISA Rabbit IgG AA 881-930, pTyr905 Log in to see Polyclonal 0
1 ABIN2884297 ELISA IF IHC IHC (p) WB Rabbit IgG AA 881-930 Log in to see Polyclonal 0
1 ABIN2744032 ICC IF IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN2744030 ICC IF IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN2744031 ICC IF IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN2885522 ELISA IF IHC IHC (p) Rabbit IgG pTyr905 Log in to see Polyclonal 0
1 ABIN5959836 ELISA IF IHC (p) WB Rabbit IgG Tyr905 Log in to see Polyclonal 0
1 ABIN3183018 ELISA IF IHC Rabbit IgG pTyr905 Log in to see Polyclonal 0
1 ABIN2350339 IF IHC ELISA WB Mouse IgM kappa Log in to see 188CT11-2-3 0
1 ABIN5950544 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG C-Term Log in to see SN20-28 0

General

Antigen Ret Proto-Oncogene (RET) Antibodies
Reactivity Human
(389), (126), (116), (10), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(256), (134), (2), (2), (1), (1)
Clonality
Polyclonal
Conjugate This Ret Proto-Oncogene antibody is un-conjugated
(16), (15), (15), (12), (10), (9), (8), (8), (7), (7), (7), (5), (5), (5), (5), (5), (5), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(288), (152), (127), (81), (65), (47), (28), (7), (7), (6), (6), (3), (3), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-Ret Proto-Oncogene Antibody

Target Details Ret Proto-Oncogene Application Details Handling References for anti-Ret Proto-Oncogene antibody (ABIN4350058) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
Isotype IgG
Plasmids, Primers & others

Target Details Ret Proto-Oncogene

Product Details anti-Ret Proto-Oncogene Antibody Application Details Handling References for anti-Ret Proto-Oncogene antibody (ABIN4350058) Images back to top
Antigen
Alternative Name Ret (RET Antibody Abstract)
Background Gene Symbol: RET
Gene ID 5979
UniProt P07949
Pathways RTK Signaling, Dopaminergic Neurogenesis, Regulation of Cell Size, Tube Formation

Application Details

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Handling References for anti-Ret Proto-Oncogene antibody (ABIN4350058) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Application Details References for anti-Ret Proto-Oncogene antibody (ABIN4350058) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Ret Proto-Oncogene antibody (ABIN4350058)

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Application Details Handling Images back to top
Product cited in:

Luo, Tsuchiya, Il Park, Fausel, Kanngurn, Welcsh, Dzieciatkowski, Wang, Grady: "RET is a potential tumor suppressor gene in colorectal cancer." in: Oncogene, Vol. 32, Issue 16, pp. 2037-47, 2013

Qundos, Hong, Tybring, Divers, Odeberg, Uhlen, Nilsson, Schwenk: "Profiling post-centrifugation delay of serum and plasma with antibody bead arrays." in: Journal of proteomics, Vol. 95, pp. 46-54, 2013

Images

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Application Details Handling References for anti-Ret Proto-Oncogene antibody (ABIN4350058) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ret Proto-Oncogene (RET) antibody (ABIN4350058) Immunohistochemistry-Paraffin: Ret Antibody [NBP1-84568] - Immunohistochemical staini...
Immunofluorescence (IF) image for anti-Ret Proto-Oncogene (RET) antibody (ABIN4350058) Immunocytochemistry/Immunofluorescence: Ret Antibody [NBP1-84568] - Analysis of human...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-Ret Proto-Oncogene (RET) antibody (ABIN4350058) Immunocytochemistry/Immunofluorescence: Ret Antibody - Immunofluorescent staining of...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ret Proto-Oncogene (RET) antibody (ABIN4350058) Immunohistochemistry-Paraffin: Ret Antibody - Staining of human adrenal gland shows ...