anti-Human Ret Proto-Oncogene antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Ret Proto-Oncogene Antibody (supplied by: Log in to see )

Antigen
Ret Proto-Oncogene (RET) Antibodies
  • c-ret
  • cret
  • etID315074.13
  • ret1
  • wu:fd13h01
  • X-ret
  • ret-A
  • xret
  • RET
  • MTC1
  • CDHF12
  • CDHR16
  • HSCR1
  • MEN2A
  • MEN2B
  • PTC
  • RET-ELE1
  • RET51
  • RET9
  • c-Ret
  • ret proto-oncogene receptor tyrosine kinase
  • ret proto-oncogene S homeolog
  • ret proto-oncogene
  • ret
  • ret.S
  • RET
  • Ret
Reactivity
Human
383
117
107
9
3
2
2
2
2
1
1
1
1
1
1
1
Host
Rabbit
245
138
3
2
1
1
Clonality
Polyclonal
Conjugate
This Ret Proto-Oncogene antibody is un-conjugated
16
15
15
12
12
9
8
8
7
7
7
5
5
5
5
5
5
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
272
144
92
81
65
49
26
7
6
5
4
3
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4350058
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.4843445 ABIN269684 IHC (p) IHC Mouse IgG1 C-Term Log in to see RET01 1
12.4843445 ABIN716651 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
12.4843445 ABIN4241677 IHC (p) WB Mouse IgG1 Log in to see MM0529-10F12 0
12.4843445 ABIN4350067 ICC IF IHC (p) WB Mouse IgM kappa Log in to see 188CT11-2-3 0
1 ABIN359926 EIA FACS IHC (p) WB Rabbit Ig Fraction AA 21-51, N-Term Log in to see Polyclonal 4
1 ABIN659065 IF IHC (p) WB Mouse IgM, kappa Log in to see 188CT11-2-3 3
1 ABIN115113 IHC (p) Mouse IgG1 C-Term Log in to see RET01 3
1 ABIN392038 IHC (p) WB Rabbit Ig Fraction AA 152-182, N-Term Log in to see Polyclonal 1
1 ABIN392041 IHC (p) WB Rabbit Ig Fraction AA 1012-1042, C-Term Log in to see Polyclonal 1
1 ABIN359927 EIA IHC (p) Rabbit Ig Fraction C-Term Log in to see Polyclonal 0
1 ABIN359924 EIA IHC (p) WB Rabbit Ig Fraction N-Term Log in to see Polyclonal 0
1 ABIN957565 IHC (p) ELISA WB Mouse IgG1 AA 896-1063 Log in to see 8D10C9 0
1 ABIN230698 IHC (p) ELISA WB Mouse IgG1 AA 896-1063 Log in to see 0
1 ABIN230700 IHC (p) ELISA WB Mouse IgG1 AA 896-1063 Log in to see 0
1 ABIN115112 IHC (p) Mouse IgG1 C-Term Log in to see RET01 0
1 ABIN680788 IF (p) IHC (p) WB Rabbit IgG AA 998-1030 Log in to see Polyclonal 0
1 ABIN5534642 IHC (p) WB Rabbit Ig Fraction AA 152-182, N-Term Log in to see Polyclonal 0
1 ABIN5534645 IHC (p) WB Rabbit Ig Fraction AA 1012-1042, C-Term Log in to see Polyclonal 0
1 ABIN745523 IF (p) IHC (p) WB Rabbit IgG pTyr905 Log in to see Polyclonal 0
1 ABIN1930190 IHC (p) ELISA WB Mouse IgG2a, kappa AA 361-458 Log in to see 1A5 0

General

Antigen Ret Proto-Oncogene (RET) Antibodies
Reactivity Human
(383), (117), (107), (9), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(245), (138), (3), (2), (1), (1)
Clonality
Polyclonal
Conjugate This Ret Proto-Oncogene antibody is un-conjugated
(16), (15), (15), (12), (12), (9), (8), (8), (7), (7), (7), (5), (5), (5), (5), (5), (5), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(272), (144), (92), (81), (65), (49), (26), (7), (6), (5), (4), (3), (3), (2), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-Ret Proto-Oncogene Antibody

Target Details Ret Proto-Oncogene Application Details Handling References for anti-Ret Proto-Oncogene antibody (ABIN4350058) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
Isotype IgG

Target Details Ret Proto-Oncogene

Product Details anti-Ret Proto-Oncogene Antibody Application Details Handling References for anti-Ret Proto-Oncogene antibody (ABIN4350058) Images back to top
Antigen
Alternative Name Ret (RET Antibody Abstract)
Background Gene Symbol: RET
Gene ID 5979
UniProt P07949
Pathways RTK Signaling, Dopaminergic Neurogenesis, Regulation of Cell Size, Tube Formation

Application Details

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Handling References for anti-Ret Proto-Oncogene antibody (ABIN4350058) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Application Details References for anti-Ret Proto-Oncogene antibody (ABIN4350058) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Ret Proto-Oncogene antibody (ABIN4350058)

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Application Details Handling Images back to top
Product cited in:

Luo, Tsuchiya, Il Park, Fausel, Kanngurn, Welcsh, Dzieciatkowski, Wang, Grady: "RET is a potential tumor suppressor gene in colorectal cancer." in: Oncogene, Vol. 32, Issue 16, pp. 2037-47, 2013

Qundos, Hong, Tybring, Divers, Odeberg, Uhlen, Nilsson, Schwenk: "Profiling post-centrifugation delay of serum and plasma with antibody bead arrays." in: Journal of proteomics, Vol. 95, pp. 46-54, 2013

Images

Product Details anti-Ret Proto-Oncogene Antibody Target Details Ret Proto-Oncogene Application Details Handling References for anti-Ret Proto-Oncogene antibody (ABIN4350058) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ret Proto-Oncogene (RET) antibody (ABIN4350058) Immunohistochemistry-Paraffin: Ret Antibody [NBP1-84568] - Immunohistochemical staini...
Immunofluorescence (IF) image for anti-Ret Proto-Oncogene (RET) antibody (ABIN4350058) Immunocytochemistry/Immunofluorescence: Ret Antibody [NBP1-84568] - Analysis of human...