anti-Rat (Rattus) CEACAM16 antibody for Western Blotting

Recommended CEACAM16 Antibody (supplied by: Log in to see )

Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16) Antibodies
  • CEAL2
  • DFNA4B
  • Gm769
  • Bcl3
  • carcinoembryonic antigen related cell adhesion molecule 16
  • carcinoembryonic antigen-related cell adhesion molecule 16
  • CEACAM16
  • Ceacam16
Middle Region
Human, Mouse (Murine), Rat (Rattus)
This CEACAM16 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN635003
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
4.8026066 ABIN2782041 WB Rabbit Middle Region Log in to see Polyclonal 1
4.8026066 ABIN2782042 WB Rabbit Middle Region Log in to see Polyclonal 1
4.8026066 ABIN2458901 ELISA WB Rabbit Log in to see Polyclonal 0
4 ABIN463484 WB Rabbit IgG AA 337-386 Log in to see Polyclonal 0
1 ABIN889911 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN889914 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN872939 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0


Antigen Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16) Antibodies
Epitope Middle Region
(4), (3), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(34), (23), (19), (4), (4), (3), (3), (3), (1), (1)
Host Rabbit
(31), (3)
Conjugate This CEACAM16 antibody is un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(15), (13), (6), (6), (5), (3), (1), (1)
Supplier Log in to see

Product Details anti-CEACAM16 Antibody

Target Details CEACAM16 Application Details Handling Images
Specificity CEACAM16 antibody was raised against the middle region of CEACAM16
Purification Affinity purified
Immunogen CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNC
Plasmids, Primers & others

Target Details CEACAM16

Product Details anti-CEACAM16 Antibody Application Details Handling Images back to top
Alternative Name CEACAM16 (CEACAM16 Antibody Abstract)
Background CEACAM16 is a single-pass type I membrane protein.It belongs to the immunoglobulin superfamily, CEA family.It contains 2 Ig-like C2-type (immunoglobulin-like) domains. The exact function of CEACAM16 remains unknown.
Molecular Weight 53 kDa (MW of target protein)
Pathways Sensory Perception of Sound

Application Details

Product Details anti-CEACAM16 Antibody Target Details CEACAM16 Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

CEACAM16 Blocking Peptide, catalog no. 33R-9368, is also available for use as a blocking control in assays to test for specificity of this CEACAM16 antibody

Restrictions For Research Use only


Product Details anti-CEACAM16 Antibody Target Details CEACAM16 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM16 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-CEACAM16 Antibody Target Details CEACAM16 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16) (Middle Region) antibody (ABIN635003) CEACAM16 antibody used at 1 ug/ml to detect target protein.