anti-Human ITK antibody for Western Blotting

Recommended ITK Antibody (supplied by: Log in to see )

Antigen
IL2-Inducible T-Cell Kinase (ITK) Antibodies
  • Emt
  • Tcsk
  • Tsk
  • EMT
  • LPFS1
  • LYK
  • PSCTK2
  • IL2 inducible T cell kinase
  • IL2 inducible T-cell kinase
  • IL2-inducible T-cell kinase
  • Itk
  • ITK
Epitope
AA 575-617, C-Term
22
18
17
14
9
7
5
5
4
3
2
2
2
2
2
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine)
118
27
25
3
2
Host
Rabbit
76
35
23
Clonality
Polyclonal
Conjugate
This ITK antibody is un-conjugated
8
7
6
6
6
6
Application
Western Blotting (WB)
119
86
16
10
8
5
5
5
4
3
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5518767
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.080771 ABIN184605 ELISA WB Goat C-Term Log in to see Polyclonal 1
3.080771 ABIN2869313 ELISA WB Mouse IgG1 AA 2-110 Log in to see 5G12C4 3
3.080771 ABIN4880343 ELISA FACS ICC WB Mouse IgG1 Log in to see 5G6 0
3.080771 ABIN969222 ICC FACS ELISA WB Mouse IgG1 Log in to see 5G6 2
3.080771 ABIN2855946 ICC IF WB Rabbit IgG C-Term Log in to see Polyclonal 0
3.080771 ABIN4327780 ELISA FACS ICC IF WB Mouse IgG1 Log in to see 5G6 0
3.080771 ABIN1846240 ELISA FACS IF/ICC WB Mouse IgG1 Log in to see 0
3.080771 ABIN1539219 WB Rabbit Ig AA 25-54, N-Term Log in to see Polyclonal 0
3.080771 ABIN441724 WB Rabbit IgG Center Log in to see Polyclonal 0
3.080771 ABIN256939 ELISA WB Goat C-Term Log in to see Polyclonal 1
3.080771 ABIN392100 WB Rabbit Ig Fraction AA 169-198, Center Log in to see Polyclonal 0
3.080771 ABIN1873325 WB Rabbit IgG Log in to see Polyclonal 0
3.080771 ABIN5581306 ELISA FACS IF WB Mouse IgG1 Log in to see 5G6 0
3.080771 ABIN449964 ELISA WB Mouse IgG1 Log in to see 5G12C4 0
3.080771 ABIN1724708 ELISA WB Mouse IgG1 AA 2-110 Log in to see 5G12C4 2
3.080771 ABIN1844114 ELISA WB Mouse IgG1 AA 2-110 Log in to see 0
3.080771 ABIN517266 WB Mouse AA 1-620, full length Log in to see Polyclonal 0
3.080771 ABIN2465858 ELISA WB Goat C-Term Log in to see Polyclonal 0
3.080771 ABIN5928223 WB Rabbit IgG Log in to see Polyclonal 0
3.080771 ABIN5928221 WB Rabbit pTyr512 Log in to see Polyclonal 0

General

Antigen IL2-Inducible T-Cell Kinase (ITK) Antibodies
Epitope AA 575-617, C-Term
(22), (18), (17), (14), (9), (7), (5), (5), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine)
(118), (27), (25), (3), (2)
Host Rabbit
(76), (35), (23)
Clonality
Polyclonal
Conjugate This ITK antibody is un-conjugated
(8), (7), (6), (6), (6), (6)
Application Western Blotting (WB)
(119), (86), (16), (10), (8), (5), (5), (5), (4), (3), (1)
Supplier Log in to see

Product Details anti-ITK Antibody

Target Details ITK Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Tyrosine-protein kinase ITK/TSK(ITK) detection. Tested with WB in Human,Mouse.
Sequence FRLYKPRLAS THVYQIMNHC WKERPEDRPA FSRLLRQLAE IAE
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Tyrosine-protein kinase ITK/TSK(ITK) detection. Tested with WB in Human,Mouse.
Gene Name: IL2 inducible T-cell kinase
Protein Name: Tyrosine-protein kinase ITK/TSK
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ITK (575-617aa FRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE), different from the related mouse sequence by five amino acids.
Isotype IgG
Plasmids, Primers & others

Target Details ITK

Product Details anti-ITK Antibody Application Details Handling Images back to top
Antigen
Alternative Name ITK (ITK Antibody Abstract)
Background Tyrosine-protein kinase ITK/TSK, also known as interleukin-2-inducible T-cell kinase or simply ITK, is a protein that in humans is encoded by the ITK gene. It is a member of the TEC family of kinases. This gene is mapped to 5q33.3. This gene encodes an intracellular tyrosine kinase expressed in T-cells. The protein is thought to play a role in T-cell proliferation and differentiation. Furthermore, ITK is functionally important for the development and effector function of Th2 and Th17 cells.

Synonyms: EMT | Itk | LPFS1 | LYK | PSCTK 2 | PSCTK2 | TSK | Q08881
Gene ID 3702
UniProt Q08881
Pathways TCR Signaling, Fc-epsilon Receptor Signaling Pathway

Application Details

Product Details anti-ITK Antibody Target Details ITK Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only

Handling

Product Details anti-ITK Antibody Target Details ITK Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-ITK Antibody Target Details ITK Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-IL2-Inducible T-Cell Kinase (ITK) (AA 575-617), (C-Term) antibody (ABIN5518767) Western blot analysis of ITK expression in HELA whole cell lysates ( Lane 1) and NIH3...