anti-Human ACD antibody for Immunocytochemistry

Recommended ACD Antibody

Antigen
Adrenocortical Dysplasia Homolog (Mouse) (ACD) Antibodies
  • PIP1
  • PTOP
  • TINT1
  • TPP1
  • ACD
  • ACD, shelterin complex subunit and telomerase recruitment factor
  • adrenocortical dysplasia
  • ACD
  • Acd
Reactivity
Human
65
16
13
4
4
4
4
1
Host
Rabbit
49
15
7
Clonality
Polyclonal
Conjugate
This ACD antibody is un-conjugated
4
2
2
2
2
2
2
2
2
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
54
23
9
7
7
4
2
2
2
1
Options

Available images

Catalog No. ABIN4277585
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
-4.185398 ABIN4277584 FACS ICC IF WB Mouse IgG1 1A-2 0
-10.185398 ABIN5074829 ICC IF Rabbit IgG Polyclonal 0
-13.185398 ABIN6246328 FACS ICC IF WB Mouse IgG1 OTI1A2 0

General

Antigen Adrenocortical Dysplasia Homolog (Mouse) (ACD) Antibodies
Reactivity Human
(65), (16), (13), (4), (4), (4), (4), (1)
Host Rabbit
(49), (15), (7)
Clonality
Polyclonal
Conjugate This ACD antibody is un-conjugated
(4), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(54), (23), (9), (7), (7), (4), (2), (2), (2), (1)
Supplier

Product Details anti-ACD Antibody

Target Details ACD Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: IRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVA
Isotype IgG
Plasmids, Primers & others

Target Details ACD

Product Details anti-ACD Antibody Application Details Handling Images back to top
Antigen
Alternative Name ACD (ACD Antibody Abstract)
Background Gene Symbol: ACD
Gene ID 65057
UniProt Q96AP0
Pathways Telomere Maintenance

Application Details

Product Details anti-ACD Antibody Target Details ACD Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ACD Antibody Target Details ACD Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ACD Antibody Target Details ACD Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Adrenocortical Dysplasia Homolog (Mouse) (ACD) antibody (ABIN4277585) Immunohistochemistry-Paraffin: ACD Antibody [NBP2-33839] - adrenal gland
Immunofluorescence (IF) image for anti-Adrenocortical Dysplasia Homolog (Mouse) (ACD) antibody (ABIN4277585) Immunocytochemistry/Immunofluorescence: ACD Antibody [NBP2-33839] - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Adrenocortical Dysplasia Homolog (Mouse) (ACD) antibody (ABIN4277585) Immunohistochemistry-Paraffin: ACD Antibody [NBP2-33839] - Immunohistochemical staini...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Adrenocortical Dysplasia Homolog (Mouse) (ACD) antibody (ABIN4277585) Immunohistochemistry-Paraffin: ACD Antibody [NBP2-33839] - liver cancer