anti-Rat (Rattus) IRF5 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IRF5 Antibody (supplied by: Log in to see )

Interferon Regulatory Factor 5 (IRF5) Antibodies
  • IRF5
  • irf5
  • SLEB10
  • AW491843
  • mirf5
  • im:7155364
  • zgc:76986
  • interferon regulatory factor 5
  • interferon regulatory factor 5 L homeolog
  • IRF5
  • irf5
  • Irf5
  • irf5.L
AA 442-472, C-Term
Human, Mouse (Murine), Rat (Rattus)
This IRF5 antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043861
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
6.8895473 ABIN5946616 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG N-Term Log in to see SD203-07 0
1 ABIN5552797 ChIP EIA IHC (p) IP WB Goat C-Term Log in to see Polyclonal 0
1 ABIN4951486 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0


Antigen Interferon Regulatory Factor 5 (IRF5) Antibodies
Epitope AA 442-472, C-Term
(28), (17), (11), (9), (6), (5), (5), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(144), (83), (37), (11), (7), (7), (6), (5), (4), (3), (3)
Host Rabbit
(77), (57), (20), (9), (4)
Conjugate This IRF5 antibody is un-conjugated
(4), (4), (4), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(140), (78), (53), (41), (34), (31), (25), (9), (7), (6), (4), (2), (2), (1)
Supplier Log in to see

Product Details anti-IRF5 Antibody

Target Details IRF5 Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Interferon regulatory factor 5(IRF5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Interferon regulatory factor 5(IRF5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: interferon regulatory factor 5
Protein Name: Interferon regulatory factor 5
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids.
Isotype IgG
Plasmids, Primers & others

Target Details IRF5

Product Details anti-IRF5 Antibody Application Details Handling Images back to top
Alternative Name IRF5 (IRF5 Antibody Abstract)
Background Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. IRF5 gene is mapped to 7q32.1. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Multiple transcript variants encoding different isoforms have been found for this gene, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. This gene is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection.

Synonyms: Interferon regulatory factor 5 antibody|Interferon regulatory factor 5 bone marrow variant antibody|IRF 5 antibody|IRF-5 antibody|Irf5 antibody|IRF5_HUMAN antibody|SLEB10 antibody
Gene ID 3663
UniProt Q13568
Pathways TLR Signaling, Autophagy

Application Details

Product Details anti-IRF5 Antibody Target Details IRF5 Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only


Product Details anti-IRF5 Antibody Target Details IRF5 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-IRF5 Antibody Target Details IRF5 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (ABIN3043861) Anti- IRF5 Picoband antibody, IHC(P) IHC(P): Human Mammary Cancer Tissue
Immunohistochemistry (IHC) image for anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (ABIN3043861) Anti- IRF5 Picoband antibody, IHC(P) IHC(P): Mouse Spleen Tissue
Immunohistochemistry (IHC) image for anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (ABIN3043861) Anti- IRF5 Picoband antibody, IHC(P) IHC(P): Rat Spleen Tissue
Western Blotting (WB) image for anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (ABIN3043861) anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (Image 4)