anti-Human Hephaestin antibody for Western Blotting

Recommended Hephaestin Antibody (supplied by: Log in to see )

Hephaestin (HEPH) Antibodies
  • HEPH
  • C130006F04Rik
  • Cpl
  • mKIAA0698
  • sla
  • CPL
  • hephaestin
  • HEPH
  • heph
  • Heph
Human, Mouse (Murine), Rat (Rattus)
This Hephaestin antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN635918
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.820231 ABIN395505 ELISA WB Mouse IgG2a kappa AA 315-425 Log in to see 2D3 5
10.820231 ABIN1868354 ICC IHC WB Rabbit IgG AA 24-366 Log in to see Polyclonal 0
10.820231 ABIN564239 ELISA WB Mouse IgG2a kappa AA 315-424, partial Log in to see 2D3 0
10.820231 ABIN2932731 IF/ICC IHC IP WB Rabbit AA 24-366 Log in to see Polyclonal 0
5.5 ABIN1715088 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 1
4.8202314 ABIN2782835 WB Rabbit N-Term Log in to see Polyclonal 1
4 ABIN321208 WB Rabbit IgG N-Term Log in to see Polyclonal 0
4 ABIN523267 ELISA WB Mouse AA 315-424, partial Log in to see Polyclonal 0
1 ABIN207364 ELISA WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN1712603 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN2605787 ELISA WB Mouse IgG2a, kappa AA 315-424 Log in to see 0
1 ABIN1701586 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN2280829 ELISA WB Mouse IgG2a kappa AA 315-424 Log in to see 2D3 0
1 ABIN6097451 ELISA IHC WB Rabbit IgG AA 300-580 Log in to see Polyclonal 0
1 ABIN6023772 IF/ICC IHC IP WB Mouse Log in to see 0
1 ABIN803302 ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN1857044 ELISA WB Rabbit Log in to see Polyclonal 0


Antigen Hephaestin (HEPH) Antibodies
Epitope N-Term
(6), (4), (3), (2), (2), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(37), (26), (9), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(33), (6)
Conjugate This Hephaestin antibody is un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(21), (17), (13), (13), (4), (2), (2), (1)
Supplier Log in to see

Product Details anti-Hephaestin Antibody

Target Details Hephaestin Application Details Handling Images
Specificity HEPH antibody was raised against the N terminal of HEPH
Purification Affinity purified
Immunogen HEPH antibody was raised using the N terminal of HEPH corresponding to a region with amino acids MHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRG
Plasmids, Primers & others

Target Details Hephaestin

Product Details anti-Hephaestin Antibody Application Details Handling Images back to top
Alternative Name HEPH (HEPH Antibody Abstract)
Background B1AJX8(HEPH) is similar to an iron transport protein found in mouse. The mouse protein is similar to ceruloplasmin, a serum multi-copper ferroxidase, and is thought to be a membrane-bound protein responsible for transport of dietary iron from epithelial cells of the intestinal lumen into the circulatory system. In mouse, defects in this gene can lead to severe microcytic anemia. Three transcript variants encoding different isoforms have been described for this gene. The protein encoded by this gene is similar to an iron transport protein found in mouse.
Molecular Weight 100 kDa (MW of target protein)
Pathways Transition Metal Ion Homeostasis

Application Details

Product Details anti-Hephaestin Antibody Target Details Hephaestin Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

HEPH Blocking Peptide, catalog no. 33R-6088, is also available for use as a blocking control in assays to test for specificity of this HEPH antibody

Restrictions For Research Use only


Product Details anti-Hephaestin Antibody Target Details Hephaestin Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEPH antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-Hephaestin Antibody Target Details Hephaestin Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Hephaestin (HEPH) (N-Term) antibody (ABIN635918) HEPH antibody used at 1 ug/ml to detect target protein.