anti-Rat (Rattus) Prion Protein 2 (Dublet) antibody for Western Blotting

Recommended Prion Protein 2 (Dublet) Antibody (supplied by: Log in to see )

Antigen
Prion Protein 2 (Dublet) (PRND) Antibodies
  • PRND
  • DOPPEL
  • DPL
  • PrPLP
  • dJ1068H6.4
  • dpl
  • AI450264
  • Dpl
  • doppel
  • prion like protein doppel
  • PRND
  • Prnd
Reactivity
Human, Mouse (Murine), Rat (Rattus)
29
21
16
Host
Rabbit
29
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
15
13
8
5
4
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Catalog No. ABIN6719483
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1410896 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN1393003 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN1387270 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN6654126 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Prion Protein 2 (Dublet) (PRND) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(29), (21), (16)
Host Rabbit
(29)
Clonality
Polyclonal
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(15), (13), (8), (5), (4)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequence ATQAANQGEF QKPDNKLHQQ VLWRLVQELC SLKH
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence of human Doppel (ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH).
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name PRND (PRND Antibody Abstract)
Background

Synonyms: Prion-like protein doppel, PrPLP, Prion protein 2, PRND, DPL, UNQ1830/PRO3443

Background: Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.

Gene ID 23627
Pathways Transition Metal Ion Homeostasis

Application Details

Product details Target Details Handling Images back to top
Application Notes

Application details: Western blot|0.1-0.5&mu,g/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1&mu,g/mL

Comment

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Buffer Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.