anti-Human CAMK2B antibody for Immunofluorescence
Recommended CAMK2B Antibody (supplied by: Log in to see )
- Antigen
-
Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) Antibodies
show synonyms for this antigen- CAM2
- CAMK2
- CAMKB
- Camk2d
- Ck2b
- camk2
- camk2b
- cam2
- camkb
- CAMK2B
- calcium/calmodulin dependent protein kinase II beta
- calcium/calmodulin-dependent protein kinase II, beta
- calcium/calmodulin-dependent protein kinase II beta
- calcium/calmodulin dependent protein kinase (CaM kinase) II alpha S homeolog
- calcium/calmodulin dependent protein kinase (CaM kinase) II beta L homeolog
- calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
- CAMK2B
- Camk2b
- camk2a.S
- camk2b.L
- Reactivity
-
Human, Mouse (Murine), Rat (Rattus)
Alternatives - Host
-
Rabbit
Alternatives - Clonality
- Conjugate
-
This CAMK2B antibody is un-conjugated
Alternatives - Application
-
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), In vivo Studies (in vivo), Simple Western (SimWes), Western Blotting (WB)
Alternatives - Supplier
- Log in to see
- Supplier Product No.
- Log in to see
Get this product for free
Submit your validation data for this product and get a full refund. I want to validate this productAvailable images
Catalog No. ABIN4287584
Contact our Customer Service for availability and price in your country.
| Relevance Score | ABIN | Application | Conjugate | Host | Isotype | Epitope | Supplier | Clonality | References | Details |
|---|---|---|---|---|---|---|---|---|---|---|
| 10.579316 | ABIN1531792 | IF IHC ELISA WB | Rabbit | IgG | AA 256-305, pThr286 | Log in to see | Polyclonal | 1 | ||
| 10.579316 | ABIN4287582 | ICC IF WB | Rabbit | Log in to see | Polyclonal | 2 | ||||
| 10.579316 | ABIN393856 | IF WB | Mouse | IgG1 kappa | AA 405-503 | Log in to see | 6D6 | 0 | ||
| 10.579316 | ABIN560157 | IF ELISA WB | Mouse | IgG1 kappa | AA 405-502, partial | Log in to see | 6D6 | 0 | ||
| 1 | ABIN272225 | IF WB | Rabbit | Log in to see | Polyclonal | 0 | ||||
| 1 | ABIN6256533 | ELISA ICC IF IHC WB | Rabbit | IgG | pThr286 | Log in to see | Polyclonal | 0 | ||
| 1 | ABIN2738721 | IF IP ELISA WB | Alkaline Phosphatase (AP) | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738729 | IF IP ELISA WB | Streptavidin | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738724 | IF IP ELISA WB | Biotin | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738725 | IF IP ELISA WB | FITC | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738720 | IF IP ELISA WB | Atto 700 | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738716 | IF IP ELISA WB | Atto 594 | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738718 | IF IP ELISA WB | Atto 488 | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738719 | IF IP ELISA WB | Atto 655 | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738722 | IF IP ELISA WB | Atto 680 | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738723 | IF IP ELISA WB | APC | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738727 | IF IP ELISA WB | PE | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738728 | IF IP ELISA WB | PerCP | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738726 | IF IP ELISA WB | Atto 594,PE | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 | |
| 1 | ABIN2738714 | IF IP ELISA WB | Atto 390 | Mouse | IgG1, kappa | Thr287, pThr286 | Log in to see | 22B1 | 0 |
General |
|
|---|---|
| Antigen | Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) Antibodies |
| Reactivity | Human, Mouse (Murine), Rat (Rattus) Alternatives |
| Host | Rabbit Alternatives |
| Clonality | |
| Conjugate | This CAMK2B antibody is un-conjugated Alternatives |
| Application |
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), In vivo Studies (in vivo), Simple Western (SimWes), Western Blotting (WB)
Alternatives
|
| Supplier | Log in to see |
Product Details anti-CAMK2B AntibodyTarget Details CAMK2B Application Details Handling Images |
|
| Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Purification | Immunogen affinity purified |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH |
| Isotype | IgG |
| Plasmids, Primers & others | |
Target Details CAMK2BProduct Details anti-CAMK2B Antibody Application Details Handling Images back to top |
|
| Antigen | |
| Alternative Name | CaMKII beta (CAMK2B Antibody Abstract) |
| Background | Gene Symbol: CAMK2B |
| Gene ID | 816 |
| Pathways | WNT Signaling, Interferon-gamma Pathway, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity |
Application DetailsProduct Details anti-CAMK2B Antibody Target Details CAMK2B Handling Images back to top |
|
| Application Notes | Western Blot 1:500 - 1:1000, Simple Western 1:5, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500, In vivo assayFor HIER pH 6 retrieval is recommended. WB dilution: 1:100-1:500 (Rodent material) and 1:500-1:1000 (Human material). In Simple Western only 10-15 μL of the recommended dilution is used per data point. |
| Comment |
The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo. |
| Restrictions | For Research Use only |
HandlingProduct Details anti-CAMK2B Antibody Target Details CAMK2B Application Details Images back to top |
|
| Format | Liquid |
| Buffer |
PBS ( pH 7.2) and 40 % Glycerol Buffer contains: 0.02 % Sodium Azide |
| Preservative | Sodium azide |
| Precaution of Use | This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Storage | 4 °C,-20 °C |
| Storage Comment | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
ImagesProduct Details anti-CAMK2B Antibody Target Details CAMK2B Application Details Handling back to top |
|
| Supplier Images |
Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of human lateral v...
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the cor...
Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
In vivo assay: CaMKII beta Antibody [NBP1-88212] - Lane 1: NIH-3T3 cell lysate (Mouse...
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a ...
Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: Marker [kDa] 250, 130, 100,...
Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human placenta sho...
Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human cerebellum s...
Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human heart shows ...
Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of mouse brain shows ...
Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human cerebral cor...
|
