anti-Human CAMK2B antibody for Immunofluorescence

Recommended CAMK2B Antibody (supplied by: Log in to see )

Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) Antibodies
  • CAM2
  • CAMK2
  • Camk2d
  • Ck2b
  • camk2
  • camk2b
  • cam2
  • camkb
  • CAMK2B
  • calcium/calmodulin dependent protein kinase II beta
  • calcium/calmodulin-dependent protein kinase II, beta
  • calcium/calmodulin-dependent protein kinase II beta
  • calcium/calmodulin dependent protein kinase (CaM kinase) II alpha S homeolog
  • calcium/calmodulin dependent protein kinase (CaM kinase) II beta L homeolog
  • calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
  • CAMK2B
  • Camk2b
  • camk2a.S
  • camk2b.L
Human, Mouse (Murine), Rat (Rattus)
This CAMK2B antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), In vivo Studies (in vivo), Simple Western (SimWes), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4287584
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.579316 ABIN1531792 IF IHC ELISA WB Rabbit IgG AA 256-305, pThr286 Log in to see Polyclonal 1
10.579316 ABIN4287582 ICC IF WB Rabbit Log in to see Polyclonal 2
10.579316 ABIN393856 IF WB Mouse IgG1 kappa AA 405-503 Log in to see 6D6 0
10.579316 ABIN560157 IF ELISA WB Mouse IgG1 kappa AA 405-502, partial Log in to see 6D6 0
1 ABIN272225 IF WB Rabbit Log in to see Polyclonal 0
1 ABIN6256533 ELISA ICC IF IHC WB Rabbit IgG pThr286 Log in to see Polyclonal 0
1 ABIN2738721 IF IP ELISA WB Alkaline Phosphatase (AP) Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738729 IF IP ELISA WB Streptavidin Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738724 IF IP ELISA WB Biotin Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738725 IF IP ELISA WB FITC Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738720 IF IP ELISA WB Atto 700 Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738716 IF IP ELISA WB Atto 594 Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738718 IF IP ELISA WB Atto 488 Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738719 IF IP ELISA WB Atto 655 Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738722 IF IP ELISA WB Atto 680 Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738723 IF IP ELISA WB APC Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738727 IF IP ELISA WB PE Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738728 IF IP ELISA WB PerCP Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738726 IF IP ELISA WB Atto 594,PE Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0
1 ABIN2738714 IF IP ELISA WB Atto 390 Mouse IgG1, kappa Thr287, pThr286 Log in to see 22B1 0


Antigen Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(117), (79), (78), (7), (7), (6), (5), (5), (4), (4), (4), (3), (3), (1), (1), (1), (1), (1)
Host Rabbit
(92), (48)
Conjugate This CAMK2B antibody is un-conjugated
(3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), In vivo Studies (in vivo), Simple Western (SimWes), Western Blotting (WB)
(121), (72), (43), (29), (27), (17), (9), (6), (6), (1), (1)
Supplier Log in to see

Product Details anti-CAMK2B Antibody

Target Details CAMK2B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
Isotype IgG
Plasmids, Primers & others

Target Details CAMK2B

Product Details anti-CAMK2B Antibody Application Details Handling Images back to top
Alternative Name CaMKII beta (CAMK2B Antibody Abstract)
Background Gene Symbol: CAMK2B
Gene ID 816
Pathways WNT Signaling, Interferon-gamma Pathway, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity

Application Details

Product Details anti-CAMK2B Antibody Target Details CAMK2B Handling Images back to top
Application Notes Western Blot 1:500 - 1:1000, Simple Western 1:5, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500, In vivo assayFor HIER pH 6 retrieval is recommended. WB dilution: 1:100-1:500 (Rodent material) and 1:500-1:1000 (Human material). In Simple Western only 10-15 μL of the recommended dilution is used per data point.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-CAMK2B Antibody Target Details CAMK2B Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-CAMK2B Antibody Target Details CAMK2B Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry (IHC) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of human lateral v...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Simple Western (SimWes) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the cor...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
 image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) In vivo assay: CaMKII beta Antibody [NBP1-88212] - Lane 1: NIH-3T3 cell lysate (Mouse...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Simple Western (SimWes) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Western Blotting (WB) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: Marker [kDa] 250, 130, 100,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human placenta sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human cerebellum s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human heart shows ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of mouse brain shows ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human cerebral cor...