anti-Rat (Rattus) CSNK1A1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CSNK1A1 Antibody (supplied by: Log in to see )

Antigen
Casein Kinase 1, alpha 1 (CSNK1A1) Antibodies
  • CK1
  • CK1a
  • CKIa
  • HLCDGP1
  • PRO2975
  • 2610208K14Rik
  • 4632404G05Rik
  • 5430427P18Rik
  • Csnk1a
  • CHUNP6894
  • ck1alpha
  • wu:fb65a02
  • wu:fi30h04
  • wu:fj19c11
  • zgc:92158
  • KER1
  • ck1
  • CKIALPHA
  • CK-II
  • CSNK2A1
  • CG2028
  • CK I
  • CK1alpha
  • CKI
  • CKI alpha
  • CKIalpha
  • CkIa
  • Dmel\\CG2028
  • PKA-C
  • anon-WO03040301.93
  • anon-WO03040301.95
  • ck1a
  • dmCK1
  • dmckI
  • l(1)G0492
  • casein kinase 1 alpha 1
  • casein kinase 1, alpha 1
  • keratin 1
  • casein kinase 1 alpha 1 L homeolog
  • casein kinase 2 alpha 1
  • Casein kinase Ialpha
  • CSNK1A1
  • Csnk1a1
  • csnk1a1
  • KRT1
  • csnk1a1.L
  • CSNK2A1
  • CkIalpha
Epitope
AA 30-68, N-Term
25
21
19
9
7
6
5
5
5
5
5
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
161
89
77
14
13
11
10
10
6
4
4
3
2
2
2
Host
Rabbit
143
17
2
2
2
Clonality
Polyclonal
Conjugate
This CSNK1A1 antibody is un-conjugated
8
7
4
4
4
3
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
162
95
80
31
27
18
12
10
4
3
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3042767
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.117402 ABIN498265 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
7 ABIN272195 IF IHC (p) WB Rabbit Log in to see Polyclonal 0
4 ABIN5956200 ELISA IHC (p) WB Rabbit IgG pTyr321 Log in to see Polyclonal 0
4 ABIN5956199 ELISA IHC (p) WB Rabbit IgG pTyr294 Log in to see Polyclonal 0
1 ABIN2892116 IF IHC IHC (p) WB Rabbit Phe158 Log in to see Polyclonal 0
1 ABIN2883636 ELISA IHC IHC (p) WB Rabbit IgG pTyr294 Log in to see Polyclonal 0
1 ABIN2892036 IF IHC IHC (p) WB Rabbit Gln317 Log in to see Polyclonal 0
1 ABIN2619587 ICC IF IHC IHC (p) WB Rabbit Internal Region Log in to see Polyclonal 0
1 ABIN2619586 ICC IF IHC IHC (p) WB Rabbit Internal Region Log in to see Polyclonal 0
1 ABIN5956197 ELISA IF IHC (p) WB Rabbit IgG Tyr321 Log in to see Polyclonal 0
1 ABIN5956196 ELISA IF IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN5956198 ELISA IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5540211 IHC (p) WB Rabbit pTyr294 Log in to see Polyclonal 0
1 ABIN5540210 IHC (p) WB Rabbit pTyr294 Log in to see Polyclonal 0
1 ABIN4950677 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Casein Kinase 1, alpha 1 (CSNK1A1) Antibodies
Epitope AA 30-68, N-Term
(25), (21), (19), (9), (7), (6), (5), (5), (5), (5), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(161), (89), (77), (14), (13), (11), (10), (10), (6), (4), (4), (3), (2), (2), (2)
Host Rabbit
(143), (17), (2), (2), (2)
Clonality
Polyclonal
Conjugate This CSNK1A1 antibody is un-conjugated
(8), (7), (4), (4), (4), (3), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(162), (95), (80), (31), (27), (18), (12), (10), (4), (3), (2), (2)
Supplier Log in to see

Product Details anti-CSNK1A1 Antibody

Target Details CSNK1A1 Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequence DIYLAINITN GEEVAVKLES QKARHPQLLY ESKLYKILQ
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: casein kinase 1, alpha 1
Protein Name: Casein kinase I isoform alpha
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.
Isotype IgG
Plasmids, Primers & others

Target Details CSNK1A1

Product Details anti-CSNK1A1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name CSNK1A1 (CSNK1A1 Antibody Abstract)
Background Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.

Synonyms: Casein kinase 1 alpha 1 antibody|Casein kinase I isoform alpha antibody|CK1 antibody|CK1A antibody|CKI alpha antibody|CKI-alpha antibody|CKIa antibody|Clock regulator kinase antibody|Csnk1a1 antibody|Down regulated in lung cancer antibody|HLCDGP1 antibody| KC1A_HUMAN antibody|PRO2975 antibody
Gene ID 1452
UniProt P48729
Pathways WNT Signaling, Hedgehog Signaling

Application Details

Product Details anti-CSNK1A1 Antibody Target Details CSNK1A1 Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-CSNK1A1 Antibody Target Details CSNK1A1 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-CSNK1A1 Antibody Target Details CSNK1A1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (ABIN3042767) Anti- CSNK1A1 Picoband antibody,IHC(P) IHC(P): Human Intestinal Cancer Tissue
Western Blotting (WB) image for anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (ABIN3042767) anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (Image 2)
Immunohistochemistry (IHC) image for anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (ABIN3042767) Anti- CSNK1A1 Picoband antibody,IHC(P) IHC(P): Rat Intestine Tissue
Immunohistochemistry (IHC) image for anti-Casein Kinase 1, alpha 1 (CSNK1A1) (AA 30-68), (N-Term) antibody (ABIN3042767) Anti- CSNK1A1 Picoband antibody,IHC(P) IHC(P): Mouse Intestine Tissue