anti-Human FZD3 antibody for Immunohistochemistry

Recommended FZD3 Antibody (supplied by: Log in to see )

Frizzled Family Receptor 3 (FZD3) Antibodies
  • FZD3
  • fz3
  • Fz-3
  • Xfz3
  • frz3
  • hfz3
  • frz-3
  • frizzled3
  • frizzled-3
  • FZ-3
  • AU020229
  • D930050A07Rik
  • Fz3
  • frizzled class receptor 3
  • frizzled class receptor 3 L homeolog
  • FZD3
  • fzd3
  • Fzd3
  • fzd3.L
Human, Mouse (Murine), Rat (Rattus)
This FZD3 antibody is un-conjugated
Immunohistochemistry (IHC), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5693226
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.539921 ABIN2879282 ELISA IF IHC IHC (p) WB Rabbit IgG AA 481-530 Log in to see Polyclonal 0
8.539921 ABIN1048620 IHC IHC (p) Rabbit N-Term Log in to see Polyclonal 0
8.539921 ABIN1048621 IHC IHC (p) Rabbit N-Term Log in to see Polyclonal 0
8.539921 ABIN2431915 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
8.539921 ABIN2426487 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN440985 IHC WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN4898967 CyTOF FACS IHC Rat IgG2a AA 1-157 Log in to see 169310 3
1 ABIN2854269 IHC WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN470848 FACS ICC IHC IHC (fro) WB Biotin Rat IgG2a Cysteine-Rich Domain, Extracellular Log in to see 0
1 ABIN470847 ELISA FACS IHC IHC (fro) WB Rat IgG2a Cysteine-Rich Domain, Extracellular Log in to see 0
1 ABIN6098901 ELISA IHC WB Rabbit IgG AA 23-205 Log in to see Polyclonal 0
1 ABIN6095923 ELISA IHC Rabbit IgG AA 23-205 Log in to see Polyclonal 0
1 ABIN2270526 IHC Rabbit N-Term Log in to see Polyclonal 0
1 ABIN2270524 IHC Rabbit N-Term Log in to see Polyclonal 0
1 ABIN2270525 IHC Rabbit C-Term Log in to see Polyclonal 0
1 ABIN6039634 ELISA IHC Rabbit IgG Log in to see Polyclonal 0
1 ABIN6040288 ELISA IHC Rabbit IgG Log in to see Polyclonal 0


Antigen Frizzled Family Receptor 3 (FZD3) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(133), (79), (26), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1)
Host Rabbit
(95), (21), (16), (7)
Conjugate This FZD3 antibody is un-conjugated
(7), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(76), (64), (27), (22), (21), (20), (13), (5), (4), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-FZD3 Antibody

Target Details FZD3 Application Details Handling Images
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for FZD3 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL).
Plasmids, Primers & others

Target Details FZD3

Product Details anti-FZD3 Antibody Application Details Handling Images back to top
Alternative Name FZD3 (FZD3 Antibody Abstract)

Synonyms: Frizzled-3, Fz-3, hFz3, FZD3

Tissue Specificity: Widely expressed. Relatively high expression in the CNS, including regions of the limbic system, in kidney, pancreas, skeletal muscle, uterus and testis.

Background: Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.

Pathways WNT Signaling, Tube Formation

Application Details

Product Details anti-FZD3 Antibody Target Details FZD3 Handling Images back to top
Application Notes

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5&mu,g/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1&mu,g/mL

Restrictions For Research Use only


Product Details anti-FZD3 Antibody Target Details FZD3 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Buffer Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-FZD3 Antibody Target Details FZD3 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) Western blot analysis of FZD3 using anti-FZD3 antibody . Electrophoresis was perform...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) IHC analysis of FZD3 using anti-FZD3 antibody . FZD3 was detected in paraffin-embedde...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) IHC analysis of FZD3 using anti-FZD3 antibody . FZD3 was detected in paraffin-embedde...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) IHC analysis of FZD3 using anti-FZD3 antibody . FZD3 was detected in paraffin-embedde...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) IHC analysis of FZD3 using anti-FZD3 antibody . FZD3 was detected in paraffin-embedde...