anti-Mouse (Murine) FZD3 antibody for Immunohistochemistry

Recommended FZD3 Antibody (supplied by: Log in to see )

Antigen
Frizzled Family Receptor 3 (FZD3) Antibodies
  • Fz-3
  • FZ-3
  • fz3
  • Xfz3
  • frz3
  • hfz3
  • frz-3
  • frizzled3
  • frizzled-3
  • FZD3
  • AU020229
  • D930050A07Rik
  • Fz3
  • fz9
  • fzd3
  • zg09
  • fzd3l
  • frizzled class receptor 3
  • frizzled class receptor 3 L homeolog
  • frizzled class receptor 3a
  • frizzled class receptor 3b
  • FZD3
  • fzd3
  • fzd3.L
  • Fzd3
  • fzd3a
  • fzd3b
Reactivity
Human, Mouse (Murine), Rat (Rattus)
123
70
26
3
3
3
3
3
3
3
3
1
1
Host
Rabbit
92
16
14
7
Clonality
Polyclonal
Conjugate
This FZD3 antibody is un-conjugated
7
4
4
4
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
72
62
24
22
20
14
13
4
4
2
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5693226
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.992594 ABIN1048620 IHC IHC (p) Rabbit N-Term Log in to see Polyclonal 0
12.760653 ABIN2854269 IHC WB Rabbit IgG N-Term Log in to see Polyclonal 0
9.992594 ABIN1048621 IHC IHC (p) Rabbit N-Term Log in to see Polyclonal 0
9.992594 ABIN2426487 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
9.992594 ABIN2431915 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
6.992594 ABIN2879282 ELISA IF IHC IHC (p) WB Rabbit IgG AA 481-530 Log in to see Polyclonal 0
5.5 ABIN4898967 CyTOF FACS IHC Rat IgG2a AA 1-157 Log in to see 169310 3
1 ABIN4898965 FACS IHC WB Biotin Rat IgG2a AA 1-157 Log in to see 169310 0
1 ABIN470848 FACS ICC IHC IHC (fro) WB Biotin Rat IgG2a Cysteine-Rich Domain, Extracellular Log in to see 0
1 ABIN470847 ELISA FACS IHC IHC (fro) WB Rat IgG2a Cysteine-Rich Domain, Extracellular Log in to see 0
1 ABIN301678 ICC IHC WB Goat IgG Cysteine-Rich Domain, Extracellular Log in to see Polyclonal 0
1 ABIN2269666 IC FACS IHC WB Biotin Rat IgG2a Log in to see 9j126 0
1 ABIN6039634 ELISA IHC Rabbit IgG Log in to see Polyclonal 0
1 ABIN6040288 ELISA IHC Rabbit IgG Log in to see Polyclonal 0
1 ABIN2269665 FACS IHC ELISA Rat IgG2a Log in to see 9j126 0
1 ABIN2269667 IC IHC ELISA WB Goat IgG Log in to see Polyclonal 0

General

Antigen Frizzled Family Receptor 3 (FZD3) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(123), (70), (26), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1)
Host Rabbit
(92), (16), (14), (7)
Clonality
Polyclonal
Conjugate This FZD3 antibody is un-conjugated
(7), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(72), (62), (24), (22), (20), (14), (13), (4), (4), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-FZD3 Antibody

Target Details FZD3 Application Details Handling Images
Sequence MPNLLNHYDQ QTAALAMEPF HPMVNLDCSR DFRPFL
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for FZD3 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL).
Plasmids, Primers & others

Target Details FZD3

Product Details anti-FZD3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name FZD3 (FZD3 Antibody Abstract)
Background

Synonyms: Frizzled-3, Fz-3, hFz3, FZD3

Tissue Specificity: Widely expressed. Relatively high expression in the CNS, including regions of the limbic system, in kidney, pancreas, skeletal muscle, uterus and testis.

Background: Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.

Pathways WNT Signaling, Tube Formation

Application Details

Product Details anti-FZD3 Antibody Target Details FZD3 Handling Images back to top
Application Notes

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5&mu,g/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1&mu,g/mL

Restrictions For Research Use only

Handling

Product Details anti-FZD3 Antibody Target Details FZD3 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Buffer Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-FZD3 Antibody Target Details FZD3 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) Western blot analysis of FZD3 using anti-FZD3 antibody . Electrophoresis was perform...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) IHC analysis of FZD3 using anti-FZD3 antibody . FZD3 was detected in paraffin-embedde...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) IHC analysis of FZD3 using anti-FZD3 antibody . FZD3 was detected in paraffin-embedde...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) IHC analysis of FZD3 using anti-FZD3 antibody . FZD3 was detected in paraffin-embedde...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 3 (FZD3) antibody (ABIN5693226) IHC analysis of FZD3 using anti-FZD3 antibody . FZD3 was detected in paraffin-embedde...