anti-Human WNT9B antibody for Immunohistochemistry

Recommended WNT9B Antibody (supplied by: Log in to see )

Antigen
Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) Antibodies
  • WNT14B
  • WNT15
  • WNT9B
  • wnt-9b
  • Wnt14b
  • Wnt15
  • clf
  • clf1
  • wnt-14b
  • wnt-15
  • Wnt family member 9B
  • wingless-type MMTV integration site family member 9B L homeolog
  • protein Wnt-9b
  • wingless-type MMTV integration site family, member 9B
  • WNT9B
  • wnt9b.2.L
  • Wnt9b
  • LOC468296
  • wnt9b
Epitope
C-Term
10
4
2
2
2
2
1
1
1
1
1
Reactivity
Human
49
13
5
3
3
3
2
2
2
2
1
Host
Rabbit
30
17
2
1
Clonality
Polyclonal
Conjugate
This WNT9B antibody is un-conjugated
2
2
2
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
33
27
13
12
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN630146
$ 388.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.992908 ABIN2776704 IHC WB Rabbit C-Term Log in to see Polyclonal 2
9.992908 ABIN1049489 IHC IHC (p) Rabbit Internal Region Log in to see Polyclonal 0
9.992908 ABIN1049490 IHC IHC (p) Rabbit Internal Region Log in to see Polyclonal 0
7 ABIN202335 IHC IHC (p) WB Rabbit IgG AA 231-280 Log in to see Polyclonal 0
4 ABIN2462373 IHC ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN6107519 ELISA IHC Rabbit IgG AA 213-324 Log in to see Polyclonal 0
1 ABIN2390321 IHC Rabbit Log in to see Polyclonal 0
1 ABIN2390320 IHC Rabbit Log in to see Polyclonal 0
1 ABIN6028414 IF/ICC IHC IP WB Mouse Log in to see 0
1 ABIN6035896 IF/ICC IHC IP WB Rabbit Log in to see Polyclonal 0

General

Antigen Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) Antibodies
Epitope C-Term
(10), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human
(49), (13), (5), (3), (3), (3), (2), (2), (2), (2), (1)
Host Rabbit
(30), (17), (2), (1)
Clonality
Polyclonal
Conjugate This WNT9B antibody is un-conjugated
(2), (2), (2), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(33), (27), (13), (12), (2), (2), (1)
Supplier Log in to see

Product Details anti-WNT9B Antibody

Target Details WNT9B Application Details Handling Images
Specificity WNT9 B antibody was raised against the C terminal of WNT9
Purification Purified
Immunogen WNT9 B antibody was raised using the C terminal of WNT9 corresponding to a region with amino acids FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD
Plasmids, Primers & others

Target Details WNT9B

Product Details anti-WNT9B Antibody Application Details Handling Images back to top
Antigen
Alternative Name WNT9B (WNT9B Antibody Abstract)
Background WNT9B is a member of the WNT family. They are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.
Molecular Weight 39 kDa (MW of target protein)
Pathways WNT Signaling, Tube Formation

Application Details

Product Details anti-WNT9B Antibody Target Details WNT9B Handling Images back to top
Application Notes WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

WNT9B Blocking Peptide, catalog no. 33R-3045, is also available for use as a blocking control in assays to test for specificity of this WNT9B antibody

Restrictions For Research Use only

Handling

Product Details anti-WNT9B Antibody Target Details WNT9B Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-WNT9B Antibody Target Details WNT9B Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (C-Term) antibody (ABIN630146) WNT9B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Western Blotting (WB) image for anti-Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B) (C-Term) antibody (ABIN630146) WNT9B antibody used at 5 ug/ml to detect target protein.