Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1105441

protein ariadne-2 homolog (ARIH2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARI2, TRIAD1, UIP48, AI843547
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus), Xenopus laevis
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN1105441
Quantity 0.1 mg
Price
324.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 6 to 8 Business Days
Immunogen The immunogen for anti-ARIH2 antibody: synthetic peptide directed towards the N terminal of human ARIH2
Sequence EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCL
Purification Purified using Protein A affinity column
Alternative Name ARIH2 / TRIAD1
Background ARIH2 might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates.
Alternate names: ARI2, HT005, Protein ariadne-2 homolog
Gene ID 10425
NCBI Accession NP_006312
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Marteijn, van Emst, Erpelinck-Verschueren et al.: "The E3 ubiquitin-protein ligase Triad1 inhibits clonogenic growth of primary myeloid progenitor cells." in: Blood, Vol. 106, Issue 13, pp. 4114-23, 2005 (PubMed).

Alternatives for antigen "protein ariadne-2 homolog (ARIH2)", type "Antibodies"
Hosts (28), (7), (5)
Reactivities (39), (17), (17), (13), (13), (13), (2), (1)
Applications (25), (13), (10), (7), (4), (3), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (5), (2), (2), (2), (1), (1)
Beacon