Did you know that you can buy products from over 140 different suppliers from us?

MRG-Binding Protein (MRGBP) (N-Term) antibody

Details for Product No. ABIN1108299
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms c20orf20, zgc:73167, C20orf20, Eaf7, MRG15BP, URCC4, 1600027N09Rik, AW060503, C80444
Epitope
N-Term
(8), (7), (2), (2), (2), (1), (1)
Reactivity
Cow (Bovine), Human, Mouse (Murine)
(17), (3), (3), (2)
Host
Rabbit
(17), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (7), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 0.1 mg
Shipping to United States (Change)
Availability Will be delivered in 6 to 8 Business Days
Catalog No. ABIN1108299
335.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for anti-C20ORF20 antibody: synthetic peptide directed towards the N terminal of human C20ORF20
Sequence MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVG
Purification Purified using Protein A affinity column
Alternative Name MRGBP
Background MRGBP alos called C20orf20 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Alternate names: C20orf20, MRG-binding protein
Gene ID 55257
NCBI Accession NP_060740
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Cai, Jin, Tomomori-Sato et al.: "Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex." in: The Journal of biological chemistry, Vol. 278, Issue 44, pp. 42733-6, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1108299
335.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top