Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1108412

Neurogenic Differentiation 6 (NEUROD6) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms nex1, Xath2, atoh2, math2, nex1m, bhlha2, math-2, neurod6-A, RGD1562793, Atoh2, MATH2, Math-2, NEX1M, Nex1, bHLHa2, Math2, Nex, Nex1m, MGC145341
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN1108412
Quantity 50 µg
Price
390.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 6 to 8 Business Days
Immunogen The immunogen for anti-NEUROD6 antibody: synthetic peptide directed towards the middle region of human NEUROD6.
Sequence RSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPE
Purification Purified using peptide immunoaffinity column
Alternative Name NEUROD6
Background NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.
Alternate names: ATOH2, My051, Neurogenic differentiation factor 6
Gene ID 63974
NCBI Accession NP_073565
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Neurogenic Differentiation 6 (NEUROD6)", type "Antibodies"
Hosts (23), (3)
Reactivities (25), (17), (15), (15), (3), (3), (1), (1)
Applications (16), (10), (8), (4), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (1), (1), (1), (1)
Beacon