Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1108490

Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAR, CAR1, MB67, AA209988, AI551208, CAR-beta, Care2, ESTM32, CXR
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN1108490
Quantity 0.1 mg
Price
324.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 6 to 8 Business Days
Immunogen The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of human NR1I3.
Sequence FHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQS
Purification Purified using Protein A affinity column
Alternative Name NR1I3 / CAR
Background NR1I3 is a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members.
Alternate names: Constitutive activator of retinoid response, Constitutive androstane receptor, MB67, Nuclear receptor subfamily 1, Orphan nuclear receptor MB67, group I, member 3
Gene ID 9970
NCBI Accession NP_005113
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Ferguson, Chen, LeCluyse et al.: "Human CYP2C8 is transcriptionally regulated by the nuclear receptors constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha." in: Molecular pharmacology, Vol. 68, Issue 3, pp. 747-57, 2005 (PubMed).

Alternatives for antigen "Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3)", type "Antibodies"
Hosts (36), (1)
Reactivities (30), (12), (7), (4), (3), (2), (1), (1), (1)
Applications (37), (16), (9), (8), (3), (2)
Epitopes (8), (4), (4), (3), (2), (2), (1), (1), (1), (1)
Beacon