Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1108907

RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
A-270G1.2, TIFIA, RGD1305001, AL023001, E130302O19Rik, R75565, TIF-1A, Tif1a, RRN3, DKFZp459B073, CG16938, CG3278, CG5951, Dmel\\CG3278, TIF-IA, Tif-1A, TifIA, dTIF-IA, dyak_GLEANR_13182, DyakGE12956, ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN1108907
Quantity 50 µg
Price
390.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 6 to 8 Business Days
Immunogen he immunogen for anti-RRN3 antibody: synthetic peptide directed towards the C terminal of human RRN3.
Sequence KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYM
Purification Purified using peptide immunoaffinity column
Alternative Name RRN3
Background RRN3 is RNA polymerase I-specific transcription initiation factor. Phosphorylation of RRN3 by MAPK cascades links cell signaling with the control of gene expression, namely results in rRNA synthesis in turn cell growth.
Alternate names: RNA polymerase I-specific transcription initiation factor RRN3, TIF-IA, TIFIA, Transcription initiation factor IA
Gene ID 54700
NCBI Accession NP_060897
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Miller, Panov, Friedrich et al.: "hRRN3 is essential in the SL1-mediated recruitment of RNA Polymerase I to rRNA gene promoters." in: The EMBO journal, Vol. 20, Issue 6, pp. 1373-82, 2001 (PubMed).

Alternatives for antigen "RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3)", type "Antibodies"
Hosts (22), (3)
Reactivities (25), (3), (3), (3), (2), (2), (2)
Applications (25), (13), (8), (1), (1)
Epitopes (7), (6), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon