Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1109360

TSC22 Domain Family, Member 4 (TSC22D4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tilz2, AI415410, Thg-1pit, 0610009M14Rik, 1700023B23Rik, THG-1, THG1, TILZ2, thg-1pit, TSC22D4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human, Pig (Porcine)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN1109360
Quantity 0.1 mg
Price
324.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 6 to 8 Business Days
Immunogen The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4
Sequence SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPD
Purification Protein A affinity column
Alternative Name TSC22D4
Background TSC22D4 is a leucine zipper-containing protein that is highly conserved during evolution. It is transcriptionally up-regulated by many different stimuli, including anti-cancer drugs and growth inhibitors. TSC22D4 may play a suppressive role in tumorigenesis.
Alternate names: TILZ2, TSC22 domain family protein 4, TSC22-related-inducible leucine zipper protein 2, Tsc-22-like protein THG-1
Gene ID 81628
NCBI Accession NP_112197
Restrictions For Research Use only
Reconstitution Add 100 µL of distilled water
Handling Advice Avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term
Expiry Date 12 months
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "TSC22 Domain Family, Member 4 (TSC22D4)", type "Antibodies"
Hosts (11), (8)
Reactivities (15), (6), (6), (1), (1), (1)
Applications (18), (9), (7), (3), (1), (1)
Epitopes (6), (5), (1), (1)
Beacon