Did you know that you can buy products from over 140 different suppliers from us?

Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) (Middle Region) antibody

Details for Product No. ABIN1109499
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcfl1, si:dkeyp-24a7.1, YL1, CFL1, Swc2, YL-1, TCFL1, CG4621, Dmel\\CG4621, dYL-1, vps72, MGC82727, Vps72, ACYPI009531
Epitope
Middle Region
(4), (3), (3), (1), (1), (1), (1)
Reactivity
Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis
(29), (17), (5), (1), (1), (1), (1), (1)
Host
Rabbit
(26), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(30), (13), (9), (3), (3), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Shipping to United States (Change)
Availability Will be delivered in 6 to 8 Business Days
Catalog No. ABIN1109499
401.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for anti-TCFL1 antibody: synthetic peptide directed towards the middle region of human TCFL1
Sequence TEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPK
Purification Purified using peptide immunoaffinity column
Alternative Name VPS72
Background TCFL1 or VPS72 encodes the YL-1 protein which is a subunit of the TRRAP/TIP60 HAT complex, and also is a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP. It could act as a DNA-binding transcriptional regulator and may be involved in chromatin modification and remodeling.
Alternate names: TCFL1, Vacuolar protein sorting-associated protein 72 homolog, YL1
Gene ID 6944
NCBI Accession NP_005988
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Horikawa, Tanaka, Yuasa et al.: "Molecular cloning of a novel human cDNA on chromosome 1q21 and its mouse homolog encoding a nuclear protein with DNA-binding ability." in: Biochemical and biophysical research communications, Vol. 208, Issue 3, pp. 999-1007, 1995 (PubMed).

Hosts (26), (4)
Reactivities (29), (17), (5), (1), (1), (1), (1), (1)
Applications (30), (13), (9), (3), (3), (2), (1), (1)
Epitopes (4), (3), (3), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1109499
401.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top