GLIS Family Zinc Finger 2 (GLIS2) (N-Term) antibody

Details for Product No. ABIN182317
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NKL, NPHP7, glis2a, nphp7, Gli5, Klf16, Nkl, glis2b, nkl-A, xNKLb, GLIS2
Epitope
N-Term
(3), (2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Human
(17), (13), (13), (13), (13), (13), (12), (1)
Host
Rabbit
(17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (8), (4), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN182317
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GLIS2
Sequence LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRY LDGVPSSFQF
Predicted Reactivity Human : 100 %, Dog : 90 %, Guinea pig : 80 %, Rat : 80 %, Mouse : 80 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against GLIS2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name GLIS2
Background Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.
Molecular Weight 56 kDa
Gene ID 84662
NCBI Accession NM_032575, NP_115964
UniProt Q9BZE0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 524 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-GLIS Family Zinc Finger 2 (GLIS2) (N-Term) antibody WB Suggested Anti-GLIS2 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Background publications Kim, Nakanishi, Lewandoski et al.: "GLIS3, a novel member of the GLIS subfamily of Krüppel-like zinc finger proteins with repressor and activation functions." in: Nucleic acids research, Vol. 31, Issue 19, pp. 5513-25, 2003 (PubMed).

Hosts (17)
Reactivities (17), (13), (13), (13), (13), (13), (12), (1)
Applications (10), (8), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top