Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182317

GLIS Family Zinc Finger 2 (GLIS2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NKL, NPHP7, glis2a, nphp7, Gli5, Klf16, Nkl, glis2b, nkl-A, xNKLb, GLIS2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182317
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2
Sequence LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRY LDGVPSSFQF
Predicted Reactivity Human : 100%, Dog : 92%, Guinea pig : 85%, Rat : 84%, Mouse : 83%, Horse : 76%
Characteristics This is a rabbit polyclonal antibody against GLIS2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name GLIS2
Background Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.
Molecular Weight 56kDa
Gene ID 84662
NCBI Accession NP_115964, NM_032575
UniProt Q9BZE0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GLIS2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kim, Nakanishi, Lewandoski et al.: "GLIS3, a novel member of the GLIS subfamily of Krüppel-like zinc finger proteins with repressor and activation functions." in: Nucleic acids research, Vol. 31, Issue 19, pp. 5513-25, 2003 (PubMed).

Alternatives for antigen "GLIS Family Zinc Finger 2 (GLIS2)", type "Antibodies"
Hosts (19)
Reactivities (19), (13), (13), (13), (13), (13), (12), (1)
Applications (10), (10), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1)
Beacon