Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182336

TSC22 Domain Family, Member 4 (TSC22D4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tilz2, AI415410, Thg-1pit, 0610009M14Rik, 1700023B23Rik, THG-1, THG1, TILZ2, thg-1pit, TSC22D4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182336
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4
Sequence SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPP RLPNGEPSPD
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against TSC22D4. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name TSC22D4
Background TSC22D4 is a leucine zipper-containing protein that is highly conserved during evolution. It is transcriptionally up-regulated by many different stimuli, including anti-cancer drugs and growth inhibitors. TSC22D4 may play a suppressive role in tumorigenesis.
Molecular Weight 41kDa
Gene ID 81628
NCBI Accession NP_112197, NM_030935
UniProt Q9Y3Q8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TSC22D4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "TSC22 Domain Family, Member 4 (TSC22D4)", type "Antibodies"
Hosts (11), (8)
Reactivities (15), (6), (6), (1), (1), (1)
Applications (18), (9), (7), (2), (1), (1), (1)
Epitopes (6), (5), (1), (1)
Beacon