Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182337

TRM1 tRNA Methyltransferase 1-Like (TRMT1L) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf25, MST070, TRM1L, bG120K12.3, 1190005F20Rik, AW226554, Trm1-like, Trm1l, RGD1307890, MGC98839, DKFZp459K016
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182337
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C1ORF25 antibody: synthetic peptide directed towards the N terminal of human C1ORF25
Sequence QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDG NFDSASSLNS
Predicted Reactivity Human :100%,   Crab-eating macaque :100%,   Sumatran orangutan :100%,   Mouse :92%,   Rat :92%,   Bovine :85%,  
Characteristics This is a rabbit polyclonal antibody against C1ORF25. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C1ORF25
Background Although C1orf25 is similar to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms, the true function of C1orf25 protein is not known.
Molecular Weight 61kDa
Gene ID 81627
NCBI Accession AAH26883
UniProt Q5XKG7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C1ORF25 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "TRM1 tRNA Methyltransferase 1-Like (TRMT1L)", type "Antibodies"
Hosts (18), (2)
Reactivities (19), (13), (13), (12), (12)
Applications (10), (10), (5), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1), (1), (1)
Beacon