Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182351

Kruppel-Like Factor 9 (KLF9) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTEB, BTEB1, 2310051E17Rik, AA589643, BTEB-1, Bteb1, ENSMUSG00000055440, Gm9971, Bteb, bteb1-B
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182351
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for Anti-KLF9 antibody is: synthetic peptide directed towards the N-terminal region of Human KLF9
Sequence LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQ TPSVCSDSLE
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against KLF9. It was validated on Western Blot. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name KLF9
Background KLF9 is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.
Molecular Weight 27kDa
Gene ID 687
NCBI Accession NP_001197, NM_001206
UniProt Q13886
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final Anti-KLF9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Imataka, Nakayama, Yasumoto et al.: "Cell-specific translational control of transcription factor BTEB expression. The role of an upstream AUG in the 5'-untranslated region." in: The Journal of biological chemistry, Vol. 269, Issue 32, pp. 20668-73, 1994 (PubMed).

Alternatives for antigen "Kruppel-Like Factor 9 (KLF9)", type "Antibodies"
Hosts (19), (6)
Reactivities (25), (14), (14), (14), (14), (12), (12)
Applications (14), (10), (9), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (2), (1)
Beacon