Kruppel-Like Factor 9 (KLF9) (N-Term) antibody

Details for Product No. ABIN182351
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms BTEB, BTEB1, 2310051E17Rik, AA589643, BTEB-1, Bteb1, ENSMUSG00000055440, Gm9971, Bteb, bteb1-B
Epitope
N-Term
(6), (2), (1)
Reactivity
Human
(22), (14), (14), (14), (14), (12), (12)
Host
Rabbit
(19), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(12), (10), (6), (5), (3)
Pubmed 1 reference available
Catalog no. ABIN182351
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for Anti-KLF9 antibody is: synthetic peptide directed towards the N-terminal region of Human KLF9
Sequence LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQ TPSVCSDSLE
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against KLF9. It was validated on Western Blot.
Purification Affinity Purified
Alternative Name KLF9
Background KLF9 is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.
Molecular Weight 27 kDa
Gene ID 687
NCBI Accession NM_001206, NP_001197
UniProt Q13886
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 244 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kruppel-Like Factor 9 (KLF9) (N-Term) antibody WB Suggested Anti-KLF9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
anti-Kruppel-Like Factor 9 (KLF9) (N-Term) antibody (2) anti-Kruppel-Like Factor 9 (KLF9) (N-Term) antibody (Image 2)
anti-Kruppel-Like Factor 9 (KLF9) (N-Term) antibody (3) anti-Kruppel-Like Factor 9 (KLF9) (N-Term) antibody (Image 3)
Product cited in: Imataka, Nakayama, Yasumoto et al.: "Cell-specific translational control of transcription factor BTEB expression. The role of an upstream AUG in the 5'-untranslated region." in: The Journal of biological chemistry, Vol. 269, Issue 32, pp. 20668-73, 1994 (PubMed).

Hosts (19), (3)
Reactivities (22), (14), (14), (14), (14), (12), (12)
Applications (12), (10), (6), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (1)
back to top