SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody

Details for Product No. ABIN182378, Supplier: Login to see New
New
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms d11moh34, vps22, Dot3, EAP30, VPS22, D11moh34, RGD1310144, D11Moh34, D11MOH34, zgc:101578
Epitope
N-Term
(23), (15), (5), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Chicken, Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio)
(48), (13), (10), (3), (3), (3), (3), (1), (1), (1)
Host
Rabbit
(42), (6), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(47), (20), (7), (3), (3), (1), (1)
Pubmed 1 reference available
ProductDetails: Supplier Login to see New
ProductDetails: Supplier Product Number Login to see New
Quantity 50 μg
Options
Shipping to United States ( )
Availability Will be delivered in 2 to 3 Business Days
Immunogen Synthetic peptide directed towards the N terminal of human EAP30
Sequence MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQL DMFKTNLEEF
Predicted Reactivity African clawed frog :100 %,   Western clawed frog :100 %,   Bovine :100 %,   Channel catfish :100 %,   blue catfish :100 %,   Dog :100 %,   Chicken :100 %,   Rat :100 %,   Atlantic salmon :100 %,   Mouse :100 %,   Human :100 %,   Japanese pufferfish :90 %,   Zebrafish :90 %,   Florida lancelet :80 %,  
Characteristics This is a rabbit polyclonal antibody against SNF8. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name EAP30 (SNF8 Antibody Abstract)
Background ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL, MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741], Kamura et al., 2001 [PubMed 11278625]).
Molecular Weight 29 kDa
Gene ID 11267
NCBI Accession NP_009172, NM_007241
UniProt Q96H20
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 258 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
Western Blotting (WB) image for anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody (ABIN182378) anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody
Immunohistochemistry (IHC) image for anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody (ABIN182378) anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody (Image 2)
Immunohistochemistry (IHC) image for anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody (ABIN182378) anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody (Image 3)
Immunohistochemistry (IHC) image for anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody (ABIN182378) Human Heart
Background publications Schmidt, Miller, Schmidt et al.: "Cloning and characterization of the EAP30 subunit of the ELL complex that confers derepression of transcription by RNA polymerase II." in: The Journal of biological chemistry, Vol. 274, Issue 31, pp. 21981-5, 1999 (PubMed).

Catalog No. ABIN182378
$289.00
Plus shipping costs $45.00

Order hotline:

  • +1 877 302 8632
  • +1 888 205 9894 (TF)
Did you look for something else?