Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182378

SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Dot3, EAP30, VPS22, D11moh34, RGD1310144, D11MOH34, D11Moh34, zgc:101578, vps22, d11moh34
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182378
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30
Sequence MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQL DMFKTNLEEF
Predicted Reactivity African clawed frog :100%,   Western clawed frog :100%,   Bovine :100%,   Channel catfish :100%,   blue catfish :100%,   Dog :100%,   Chicken :100%,   Rat :100%,   Atlantic salmon :100%,   Mouse :100%,   Human :100%,   Japanese pufferfish :92%,   Zebrafish :92%,   Florida lancelet :83%,  
Characteristics This is a rabbit polyclonal antibody against SNF8. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name EAP30
Background ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL, MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741], Kamura et al., 2001 [PubMed 11278625]).
Molecular Weight 29kDa
Gene ID 11267
NCBI Accession NP_009172, NM_007241
UniProt Q96H20
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EAP30 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Schmidt, Miller, Schmidt et al.: "Cloning and characterization of the EAP30 subunit of the ELL complex that confers derepression of transcription by RNA polymerase II." in: The Journal of biological chemistry, Vol. 274, Issue 31, pp. 21981-5, 1999 (PubMed).

Alternatives for antigen "SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8)", type "Antibodies"
Hosts (24), (5), (1)
Reactivities (27), (10), (10), (2), (2), (2), (2), (1)
Applications (30), (9), (6), (3), (2), (1), (1)
Epitopes (8), (5), (2), (2), (2), (1), (1), (1), (1)
Beacon