Did you know that you can buy products from over 140 different suppliers from us?

Forkhead Box F1 (FOXF1) (N-Term) antibody

Details for Product No. ABIN182402
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FOXF1, acdmpv, fkhl5, freac1, xfd-13, foxF1, foxF, ACDMPV, FKHL5, FREAC1, foxf1, AI450827, Foxf1a, Freac-1, HFH-8, Hfh8, si:dkey-199i24.2, zgc:158301, Fkhl5, Foxf1
Epitope
N-Term
(10), (7), (6), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Human
(35), (21), (15), (15), (13), (12), (3)
Host
Rabbit
(32), (4), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (13), (10), (9), (5), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182402
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FOXF1
Sequence MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSP TKRLTLSEIY
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %
Characteristics This is a rabbit polyclonal antibody against FOXF1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name FOXF1
Background FOXF1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined, however, it may play a role in the regulation of pulmonary genes as well as embryonic development.
Molecular Weight 38 kDa
Gene ID 2294
NCBI Accession NM_001451, NP_001442
UniProt Q12946
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 354 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Forkhead Box F1 (FOXF1) (N-Term) antibody WB Suggested Anti-FOXF1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Background publications Coon, Roberts, Loscertales et al.: "Differential epithelial expression of SHH and FOXF1 in usual and nonspecific interstitial pneumonia." in: Experimental and molecular pathology, Vol. 80, Issue 2, pp. 119-23, 2006 (PubMed).

Validation Images
back to top