Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182402

Forkhead Box F1 (FOXF1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ACDMPV, FKHL5, FREAC1, AI450827, Foxf1a, Freac-1, HFH-8, Hfh8, FOXF1, si:dkey-199i24.2, zgc:158301, acdmpv, fkhl5, freac1, xfd-13, foxF1, foxF
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182402
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FOXF1 antibody: synthetic peptide directed towards the N terminal of human FOXF1
Sequence MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSP TKRLTLSEIY
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%
Characteristics This is a rabbit polyclonal antibody against FOXF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name FOXF1
Background FOXF1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined, however, it may play a role in the regulation of pulmonary genes as well as embryonic development.
Molecular Weight 38kDa
Gene ID 2294
NCBI Accession NP_001442, NM_001451
UniProt Q12946
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FOXF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Coon, Roberts, Loscertales et al.: "Differential epithelial expression of SHH and FOXF1 in usual and nonspecific interstitial pneumonia." in: Experimental and molecular pathology, Vol. 80, Issue 2, pp. 119-23, 2006 (PubMed).

Alternatives for antigen "Forkhead Box F1 (FOXF1)", type "Antibodies"
Hosts (26), (3), (3)
Reactivities (28), (21), (15), (15), (13), (13), (3)
Applications (17), (10), (10), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (5), (2), (2), (1), (1), (1)
Beacon