Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182413

Zinc Finger with KRAB and SCAN Domains 5 (ZKSCAN5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Zfp95, hKraba1, AI132486, AI326970, ZFP95, ZNF914, ZSCAN37
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182413
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZFP95 antibody: synthetic peptide directed towards the N terminal of human ZFP95
Sequence MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQE YNPPTFETFY
Predicted Reactivity Western Gorilla :100%,   Pygmy chimpanzee :100%,   Pig-tailed macaque :100%,   Chimpanzee :100%,   Human :100% Red-chested mustached tamarin :92%,   Common woolly monkey :92%,   Mouse :78%,  
Characteristics This is a rabbit polyclonal antibody against ZFP95. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZFP95
Background ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis.
Molecular Weight 97kDa
Gene ID 23660
NCBI Accession NP_055384, NM_014569
UniProt Q9Y2L8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZFP95 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Zinc Finger with KRAB and SCAN Domains 5 (ZKSCAN5)", type "Antibodies"
Hosts (5), (4)
Reactivities (9)
Applications (8), (3), (3), (2)
Epitopes (3), (3), (1), (1)
Beacon