Zinc Finger with KRAB and SCAN Domains 5 (ZKSCAN5) (N-Term) antibody

Details for Product No. ABIN182413
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Zfp95, ZFP95, ZNF914, ZSCAN37, AI132486, AI326970, hKraba1
Epitope
N-Term
(3), (3), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Human
(10)
Host
Rabbit
(6), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (4), (4), (2), (1)
Pubmed 1 reference available
Quantity 100 μg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182413
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZFP95
Sequence MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQE YNPPTFETFY
Predicted Reactivity Western Gorilla :100 %,   Pygmy chimpanzee :100 %,   Pig-tailed macaque :100 %,   Chimpanzee :100 %,   Human :100 % Red-chested mustached tamarin :90 %,   Common woolly monkey :90 %,   Mouse :70 %,  
Characteristics This is a rabbit polyclonal antibody against ZFP95. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZFP95
Background ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis.
Molecular Weight 97 kDa
Gene ID 23660
NCBI Accession NM_014569, NP_055384
UniProt Q9Y2L8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 839 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger with KRAB and SCAN Domains 5 (ZKSCAN5) (N-Term) antibody WB Suggested Anti-ZFP95 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Validation Images
Did you look for something else?
back to top