Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182431

Zinc Finger and BTB Domain Containing 32 (ZBTB32) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Rog, FAXF, FAZF, PLZP, Tzfp, 4930524C15Rik, TZFP, ZNF538
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182431
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB32 antibody: synthetic peptide directed towards the N terminal of human ZBTB32
Sequence PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHS LVLAGVSQQL
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Rabbit : 100%, Horse : 92%, Mouse : 92%
Characteristics This is a rabbit polyclonal antibody against ZBTB32. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB32
Background ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.
Molecular Weight 33kDa
Gene ID 27033
UniProt Q8WVP2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB32 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Hoatlin, Zhi, Ball et al.: "A novel BTB/POZ transcriptional repressor protein interacts with the Fanconi anemia group C protein and PLZF." in: Blood, Vol. 94, Issue 11, pp. 3737-47, 1999 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 32 (ZBTB32)", type "Antibodies"
Hosts (8), (6), (3)
Reactivities (16)
Applications (16), (5), (3), (3)
Epitopes (5), (3), (3), (2), (2)
Beacon